Recombinant Human MYOD1 protein, Arginine-tagged

Cat.No. : MYOD1-143H
Product Overview : Recombinant human MYOD1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : ELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVHPAPGAR EDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILR NAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCY EGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQSP DAAPQCPAGANPNPIYQVLLEESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for human myogenesis study.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days
Gene Name MYOD1 myogenic differentiation 1 [ Homo sapiens ]
Official Symbol MYOD1
Synonyms MYOD1; myogenic differentiation 1; MYF3, myogenic factor 3; myoblast determination protein 1; bHLHc1; MYOD; PUM; myf-3; MYF3;
Gene ID 4654
mRNA Refseq NM_002478
Protein Refseq NP_002469
MIM 159970
UniProt ID P15172
Chromosome Location 11p15
Pathway C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem;
Function DNA binding; E-box binding; enzyme binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription coactivator activity; transcription factor binding; ubiquitin protein ligase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYOD1 Products

Required fields are marked with *

My Review for All MYOD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon