Recombinant Human MYOD1 protein, Arginine-tagged

• Cat.No.: MYOD1-143H
• Product Overview: Recombinant human MYOD1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: ELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVHPAPGAR EDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILR NAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCY EGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQSP DAAPQCPAGANPNPIYQVLLEESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for human myogenesis study.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days

Gene Information

• Gene Name: MYOD1 myogenic differentiation 1 [ Homo sapiens ]
• Official Symbol: MYOD1
• Synonyms: MYOD1; myogenic differentiation 1; MYF3, myogenic factor 3; myoblast determination protein 1; bHLHc1; MYOD; PUM; myf-3; MYF3
• Gene ID: 4654
• mRNA Refseq: NM_002478
• Protein Refseq: NP_002469
• MIM: 159970
• UniProt ID: P15172
• Chromosome Location: 11p15
• Pathway: C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem
• Function: DNA binding; E-box binding; enzyme binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription coactivator activity; transcription factor binding; ubiquitin protein ligase binding