"MYOD1" Related Products

Expand
Expand
Expand

Recombinant Human MYOD1 protein, Arginine-tagged

Cat.No.: MYOD1-143H
Product Overview: Recombinant human MYOD1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: ELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVHPAPGAR EDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILR NAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCY EGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQSP DAAPQCPAGANPNPIYQVLLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for human myogenesis study.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days
Gene Name: MYOD1 myogenic differentiation 1 [ Homo sapiens ]
Official Symbol: MYOD1
Synonyms: MYOD1; myogenic differentiation 1; MYF3, myogenic factor 3; myoblast determination protein 1; bHLHc1; MYOD; PUM; myf-3; MYF3;
Gene ID: 4654
mRNA Refseq: NM_002478
Protein Refseq: NP_002469
MIM: 159970
UniProt ID: P15172
Chromosome Location: 11p15
Pathway: C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem;
Function: DNA binding; E-box binding; enzyme binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription coactivator activity; transcription factor binding; ubiquitin protein ligase binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.