Recombinant Human MYOD1 protein, Arginine-tagged
Cat.No. : | MYOD1-143H |
Product Overview : | Recombinant human MYOD1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | ELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVHPAPGAR EDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILR NAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCY EGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQSP DAAPQCPAGANPNPIYQVLLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for human myogenesis study.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days |
Gene Name | MYOD1 myogenic differentiation 1 [ Homo sapiens ] |
Official Symbol | MYOD1 |
Synonyms | MYOD1; myogenic differentiation 1; MYF3, myogenic factor 3; myoblast determination protein 1; bHLHc1; MYOD; PUM; myf-3; MYF3; |
Gene ID | 4654 |
mRNA Refseq | NM_002478 |
Protein Refseq | NP_002469 |
MIM | 159970 |
UniProt ID | P15172 |
Chromosome Location | 11p15 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem; |
Function | DNA binding; E-box binding; enzyme binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription coactivator activity; transcription factor binding; ubiquitin protein ligase binding; |
◆ Recombinant Proteins | ||
MYOD1-3871R | Recombinant Rat MYOD1 Protein | +Inquiry |
MYOD1-2474H | Recombinant Human MYOD1 Protein, His-tagged | +Inquiry |
MYOD1-28655TH | Recombinant Human MYOD1 | +Inquiry |
MYOD1-3565H | Recombinant Human MYOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOD1-167H | Recombinant Human MYOD1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOD1-4005HCL | Recombinant Human MYOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOD1 Products
Required fields are marked with *
My Review for All MYOD1 Products
Required fields are marked with *