Recombinant Human MYOG
| Cat.No. : | MYOG-30274TH |
| Product Overview : | Recombinant full length Human Myogenin with N terminal proprietary tag, 50.75kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 224 amino acids |
| Description : | Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. |
| Molecular Weight : | 50.750kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTEL TLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSV DRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPS ECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN |
| Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
| Gene Name | MYOG myogenin (myogenic factor 4) [ Homo sapiens ] |
| Official Symbol | MYOG |
| Synonyms | MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3; |
| Gene ID | 4656 |
| mRNA Refseq | NM_002479 |
| Protein Refseq | NP_002470 |
| MIM | 159980 |
| Uniprot ID | P15173 |
| Chromosome Location | 1q31-q41 |
| Pathway | CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Hypertrophy Model, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem; |
| Function | DNA binding; E-box binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| MYOG-5758C | Recombinant Chicken MYOG | +Inquiry |
| MYOG-30274TH | Recombinant Human MYOG | +Inquiry |
| MYOG-8637Z | Recombinant Zebrafish MYOG | +Inquiry |
| MYOG-3566H | Recombinant Human MYOG Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYOG-5867M | Recombinant Mouse MYOG Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOG Products
Required fields are marked with *
My Review for All MYOG Products
Required fields are marked with *
