Recombinant Human MYOG
Cat.No. : | MYOG-30274TH |
Product Overview : | Recombinant full length Human Myogenin with N terminal proprietary tag, 50.75kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 224 amino acids |
Description : | Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. |
Molecular Weight : | 50.750kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTEL TLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSV DRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPS ECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name | MYOG myogenin (myogenic factor 4) [ Homo sapiens ] |
Official Symbol | MYOG |
Synonyms | MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3; |
Gene ID | 4656 |
mRNA Refseq | NM_002479 |
Protein Refseq | NP_002470 |
MIM | 159980 |
Uniprot ID | P15173 |
Chromosome Location | 1q31-q41 |
Pathway | CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Hypertrophy Model, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem; |
Function | DNA binding; E-box binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
MYOG-5758C | Recombinant Chicken MYOG | +Inquiry |
MYOG-8637Z | Recombinant Zebrafish MYOG | +Inquiry |
MYOG-3209H | Recombinant Human MYOG protein, His-tagged | +Inquiry |
MYOG-288H | Recombinant Human MYOG | +Inquiry |
MYOG-327HF | Recombinant Full Length Human MYOG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOG Products
Required fields are marked with *
My Review for All MYOG Products
Required fields are marked with *