Recombinant Human MYOZ2 protein, His-tagged
Cat.No. : | MYOZ2-3286H |
Product Overview : | Recombinant Human MYOZ2 protein(1-264 aa), fused to His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-264 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MYOZ2 myozenin 2 [ Homo sapiens ] |
Official Symbol | MYOZ2 |
Synonyms | MYOZ2; myozenin 2; C4orf5, chromosome 4 open reading frame 5; myozenin-2; CS 1; FATZ-related protein 2; muscle-specific protein; calcineurin-binding protein calsarcin-1; CS-1; CMH16; C4orf5; |
Gene ID | 51778 |
mRNA Refseq | NM_016599 |
Protein Refseq | NP_057683 |
MIM | 605602 |
UniProt ID | Q9NPC6 |
◆ Recombinant Proteins | ||
MYOZ2-2945H | Recombinant Human Myozenin 2, T7-tagged | +Inquiry |
MYOZ2-10357M | Recombinant Mouse MYOZ2 Protein | +Inquiry |
MYOZ2-5860H | Recombinant Human MYOZ2 Protein, GST-tagged | +Inquiry |
MYOZ2-3286H | Recombinant Human MYOZ2 protein, His-tagged | +Inquiry |
MYOZ2-5871M | Recombinant Mouse MYOZ2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOZ2-4001HCL | Recombinant Human MYOZ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOZ2 Products
Required fields are marked with *
My Review for All MYOZ2 Products
Required fields are marked with *