Recombinant Human MYPN Protein, GST-tagged

Cat.No. : MYPN-5861H
Product Overview : Human MYPN partial ORF ( NP_115967, 61 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MYPN is a component of the sarcomere that tethers nebulin (MIM 161650) in skeletal muscle and nebulette (MIM 605491) in cardiac muscle to alpha-actinin (see ACTN2; MIM 102573) at the Z lines (Bang et al., 2001 [PubMed 11309420]).[supplied by OMIM
Molecular Mass : 37.84 kDa
AA Sequence : PDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKRLSPDQMKHSPNLSFEPNFCQDNPRSPTSSKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYPN myopalladin [ Homo sapiens ]
Official Symbol MYPN
Synonyms MYPN; myopalladin; MYOP; sarcomeric protein myopalladin; 145 kDa; sarcomeric protein myopalladin, 145 kDa (MYOP);
Gene ID 84665
mRNA Refseq NM_001256267
Protein Refseq NP_001243196
MIM 608517
UniProt ID Q86TC9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYPN Products

Required fields are marked with *

My Review for All MYPN Products

Required fields are marked with *

0
cart-icon
0
compare icon