Recombinant Human MYPN Protein, GST-tagged
Cat.No. : | MYPN-5861H |
Product Overview : | Human MYPN partial ORF ( NP_115967, 61 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MYPN is a component of the sarcomere that tethers nebulin (MIM 161650) in skeletal muscle and nebulette (MIM 605491) in cardiac muscle to alpha-actinin (see ACTN2; MIM 102573) at the Z lines (Bang et al., 2001 [PubMed 11309420]).[supplied by OMIM |
Molecular Mass : | 37.84 kDa |
AA Sequence : | PDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKRLSPDQMKHSPNLSFEPNFCQDNPRSPTSSKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYPN myopalladin [ Homo sapiens ] |
Official Symbol | MYPN |
Synonyms | MYPN; myopalladin; MYOP; sarcomeric protein myopalladin; 145 kDa; sarcomeric protein myopalladin, 145 kDa (MYOP); |
Gene ID | 84665 |
mRNA Refseq | NM_001256267 |
Protein Refseq | NP_001243196 |
MIM | 608517 |
UniProt ID | Q86TC9 |
◆ Recombinant Proteins | ||
MYPN-5872M | Recombinant Mouse MYPN Protein, His (Fc)-Avi-tagged | +Inquiry |
MYPN-10359M | Recombinant Mouse MYPN Protein | +Inquiry |
MYPN-5861H | Recombinant Human MYPN Protein, GST-tagged | +Inquiry |
MYPN-2501H | Recombinant Human MYPN Protein, MYC/DDK-tagged | +Inquiry |
MYPN-551H | Recombinant Human MYPN Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYPN Products
Required fields are marked with *
My Review for All MYPN Products
Required fields are marked with *
0
Inquiry Basket