Recombinant Human MYT1L Protein, GST-tagged
| Cat.No. : | MYT1L-5869H | 
| Product Overview : | Human MYT1L partial ORF ( NP_055840, 301 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a member of the zinc finger superfamily of transcription factors whose expression, thus far, has been found only in neuronal tissues. The encoded protein belongs to a novel class of cystein-cystein-histidine-cystein zinc finger proteins that function in the developing mammalian central nervous system. Forced expression of this gene in combination with the basic helix-loop-helix transcription factor NeuroD1 and the transcription factors POU class 3 homeobox 2 and achaete-scute family basic helix-loop-helix transcription factor 1 can convert fetal and postnatal human fibroblasts into induced neuronal cells, which are able to generate action potentials. Mutations in this gene have been associated with an autosomal dominant form of cognitive disability and with autism spectrum disorder. Alternative splicing results in multiple variants. [provided by RefSeq, Jul 2017] | 
| Molecular Mass : | 37.84 kDa | 
| AA Sequence : | MLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARKLSETNPQERNPQQNMNIRQHVRPEEDFPGRTPDRNYSDMLNLMRLEEQLSPRSRVFASCAKEDGCHERDD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MYT1L myelin transcription factor 1 like [ Homo sapiens (human) ] | 
| Official Symbol | MYT1L | 
| Synonyms | MYT1L; myelin transcription factor 1 like; NZF1; MRD39; myT1-L; ZC2H2C2; ZC2HC4B; myelin transcription factor 1-like protein; neural zinc finger transcription factor 1 | 
| Gene ID | 23040 | 
| mRNA Refseq | NM_001303052 | 
| Protein Refseq | NP_001289981 | 
| MIM | 613084 | 
| UniProt ID | Q9UL68 | 
| ◆ Recombinant Proteins | ||
| MYT1L-3532R | Recombinant Rat MYT1L Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MYT1L-5869H | Recombinant Human MYT1L Protein, GST-tagged | +Inquiry | 
| MYT1L-3873R | Recombinant Rat MYT1L Protein | +Inquiry | 
| MYT1L-2929R | Recombinant Rhesus monkey MYT1L Protein, His-tagged | +Inquiry | 
| MYT1L-2749R | Recombinant Rhesus Macaque MYT1L Protein, His (Fc)-Avi-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYT1L Products
Required fields are marked with *
My Review for All MYT1L Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            