Recombinant Human MZB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MZB1-4085H
• Product Overview: MGC29506 MS Standard C13 and N15-labeled recombinant protein (NP_057543) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Acts as a hormone-regulated adipokine/proinflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.
• Molecular Mass: 20.7 kDa
• AA Sequence: MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MZB1 marginal zone B and B1 cell-specific protein [ Homo sapiens (human) ]
• Official Symbol: MZB1
• Synonyms: MZB1; marginal zone B and B1 cell-specific protein; plasma cell-induced resident endoplasmic reticulum protein; HSPC190; caspase-2 binding protein; plasma cell-induced ER protein 1; proapoptotic caspase adapter protein; proapoptotic caspase adaptor protein; plasma cell-induced resident ER protein; PACAP; pERp1; FLJ32987; MGC29506
• Gene ID: 51237
• mRNA Refseq: NM_016459
• Protein Refseq: NP_057543
• MIM: 609447
• UniProt ID: Q8WU39