Recombinant Human MZB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MZB1-4085H
Product Overview : MGC29506 MS Standard C13 and N15-labeled recombinant protein (NP_057543) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Acts as a hormone-regulated adipokine/proinflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.
Molecular Mass : 20.7 kDa
AA Sequence : MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MZB1 marginal zone B and B1 cell-specific protein [ Homo sapiens (human) ]
Official Symbol MZB1
Synonyms MZB1; marginal zone B and B1 cell-specific protein; plasma cell-induced resident endoplasmic reticulum protein; HSPC190; caspase-2 binding protein; plasma cell-induced ER protein 1; proapoptotic caspase adapter protein; proapoptotic caspase adaptor protein; plasma cell-induced resident ER protein; PACAP; pERp1; FLJ32987; MGC29506;
Gene ID 51237
mRNA Refseq NM_016459
Protein Refseq NP_057543
MIM 609447
UniProt ID Q8WU39

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MZB1 Products

Required fields are marked with *

My Review for All MZB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon