Recombinant Human MZB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MZB1-4085H |
Product Overview : | MGC29506 MS Standard C13 and N15-labeled recombinant protein (NP_057543) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Acts as a hormone-regulated adipokine/proinflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance. |
Molecular Mass : | 20.7 kDa |
AA Sequence : | MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MZB1 marginal zone B and B1 cell-specific protein [ Homo sapiens (human) ] |
Official Symbol | MZB1 |
Synonyms | MZB1; marginal zone B and B1 cell-specific protein; plasma cell-induced resident endoplasmic reticulum protein; HSPC190; caspase-2 binding protein; plasma cell-induced ER protein 1; proapoptotic caspase adapter protein; proapoptotic caspase adaptor protein; plasma cell-induced resident ER protein; PACAP; pERp1; FLJ32987; MGC29506; |
Gene ID | 51237 |
mRNA Refseq | NM_016459 |
Protein Refseq | NP_057543 |
MIM | 609447 |
UniProt ID | Q8WU39 |
◆ Recombinant Proteins | ||
MZB1-1158H | Recombinant Human MZB1, GST-tagged | +Inquiry |
MZB1-348H | Recombinant Human MZB1 protein, His-tagged | +Inquiry |
MZB1-4085H | Recombinant Human MZB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MZB1-2930R | Recombinant Rhesus monkey MZB1 Protein, His-tagged | +Inquiry |
MZB1-3874R | Recombinant Rat MZB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MZB1-1029HCL | Recombinant Human MZB1 cell lysate | +Inquiry |
MZB1-4338HCL | Recombinant Human MGC29506 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MZB1 Products
Required fields are marked with *
My Review for All MZB1 Products
Required fields are marked with *
0
Inquiry Basket