Recombinant Human MZT2A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MZT2A-2731H |
Product Overview : | FAM128A MS Standard C13 and N15-labeled recombinant protein (NP_001078834) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | MZT2A (Mitotic Spindle Organizing Protein 2A) is a Protein Coding gene. Diseases associated with MZT2A include Keratoconus 9. An important paralog of this gene is MZT2B. |
Molecular Mass : | 12.5 kDa |
AA Sequence : | MELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MZT2A mitotic spindle organizing protein 2A [ Homo sapiens (human) ] |
Official Symbol | MZT2A |
Synonyms | MZT2A; mitotic spindle organizing protein 2A; FAM128A; MOZART2A; mitotic-spindle organizing protein 2A; family with sequence similarity 128, member A; mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2A |
Gene ID | 653784 |
mRNA Refseq | NM_001085365 |
Protein Refseq | NP_001078834 |
MIM | 613449 |
UniProt ID | Q6P582 |
◆ Recombinant Proteins | ||
MZT2A-2731H | Recombinant Human MZT2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MZT2A-2492H | Recombinant Human MZT2A Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MZT2A Products
Required fields are marked with *
My Review for All MZT2A Products
Required fields are marked with *
0
Inquiry Basket