Recombinant Human MZT2A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MZT2A-2731H
Product Overview : FAM128A MS Standard C13 and N15-labeled recombinant protein (NP_001078834) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : MZT2A (Mitotic Spindle Organizing Protein 2A) is a Protein Coding gene. Diseases associated with MZT2A include Keratoconus 9. An important paralog of this gene is MZT2B.
Molecular Mass : 12.5 kDa
AA Sequence : MELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MZT2A mitotic spindle organizing protein 2A [ Homo sapiens (human) ]
Official Symbol MZT2A
Synonyms MZT2A; mitotic spindle organizing protein 2A; FAM128A; MOZART2A; mitotic-spindle organizing protein 2A; family with sequence similarity 128, member A; mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2A
Gene ID 653784
mRNA Refseq NM_001085365
Protein Refseq NP_001078834
MIM 613449
UniProt ID Q6P582

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MZT2A Products

Required fields are marked with *

My Review for All MZT2A Products

Required fields are marked with *

0
cart-icon
0
compare icon