Recombinant Human NAA50 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NAA50-4182H
Product Overview : NAA50 MS Standard C13 and N15-labeled recombinant protein (NP_079422) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NAA50 (N-Alpha-Acetyltransferase 50, NatE Catalytic Subunit) is a Protein Coding gene. Diseases associated with NAA50 include Ogden Syndrome and Neuropathy, Hereditary Sensory And Autonomic, Type Iia. Among its related pathways are Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include N-acetyltransferase activity and H4 histone acetyltransferase activity. An important paralog of this gene is NAA30.
Molecular Mass : 19.4 kDa
AA Sequence : MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NAA50 N-alpha-acetyltransferase 50, NatE catalytic subunit [ Homo sapiens (human) ]
Official Symbol NAA50
Synonyms NAA50; N(alpha)-acetyltransferase 50, NatE catalytic subunit; MAK3, Mak3 homolog (S. cerevisiae), N acetyltransferase 13, N acetyltransferase 13 (GCN5 related), NAT13; N-alpha-acetyltransferase 50; FLJ13194; NAT5; San; Mak3 homolog; separation anxiety; N-acetyltransferase 5; natE catalytic subunit; N-acetyltransferase san homolog; N-acetyltransferase 13 (GCN5-related); N-alpha-acetyltransferase 50, NatE catalytic subunit; SAN; MAK3; hSAN; NAT13; hNAT5;
Gene ID 80218
mRNA Refseq NM_025146
Protein Refseq NP_079422
MIM 610834
UniProt ID Q9GZZ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAA50 Products

Required fields are marked with *

My Review for All NAA50 Products

Required fields are marked with *

0
cart-icon