Recombinant Human NAA50 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NAA50-4182H |
Product Overview : | NAA50 MS Standard C13 and N15-labeled recombinant protein (NP_079422) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NAA50 (N-Alpha-Acetyltransferase 50, NatE Catalytic Subunit) is a Protein Coding gene. Diseases associated with NAA50 include Ogden Syndrome and Neuropathy, Hereditary Sensory And Autonomic, Type Iia. Among its related pathways are Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include N-acetyltransferase activity and H4 histone acetyltransferase activity. An important paralog of this gene is NAA30. |
Molecular Mass : | 19.4 kDa |
AA Sequence : | MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NAA50 N-alpha-acetyltransferase 50, NatE catalytic subunit [ Homo sapiens (human) ] |
Official Symbol | NAA50 |
Synonyms | NAA50; N(alpha)-acetyltransferase 50, NatE catalytic subunit; MAK3, Mak3 homolog (S. cerevisiae), N acetyltransferase 13, N acetyltransferase 13 (GCN5 related), NAT13; N-alpha-acetyltransferase 50; FLJ13194; NAT5; San; Mak3 homolog; separation anxiety; N-acetyltransferase 5; natE catalytic subunit; N-acetyltransferase san homolog; N-acetyltransferase 13 (GCN5-related); N-alpha-acetyltransferase 50, NatE catalytic subunit; SAN; MAK3; hSAN; NAT13; hNAT5; |
Gene ID | 80218 |
mRNA Refseq | NM_025146 |
Protein Refseq | NP_079422 |
MIM | 610834 |
UniProt ID | Q9GZZ1 |
◆ Recombinant Proteins | ||
NAA50-1016H | Recombinant Human NAA50 | +Inquiry |
NAA50-2757R | Recombinant Rhesus Macaque NAA50 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAA50-1930H | Recombinant Human NAA50, His-tagged | +Inquiry |
NAA50-5885M | Recombinant Mouse NAA50 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAA50-1208HFL | Recombinant Full Length Human NAA50 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAA50-3991HCL | Recombinant Human NAA50 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAA50 Products
Required fields are marked with *
My Review for All NAA50 Products
Required fields are marked with *