Recombinant Human NAAA, His-tagged

• Cat.No.: NAAA-34H
• Product Overview: Recombinant Human N-Acylethanolamine-Hydrolyzing Acid Amidase/NAAA is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser29-Glu199) of Human NAAA fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 29-199 a.a.
• AA Sequence: SPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQ PFTGEIRGMCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVD VQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDPEVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: NAAA N-acylethanolamine acid amidase [ Homo sapiens ]
• Official Symbol: NAAA
• Synonyms: NAAA; N-acylethanolamine acid amidase; ASAHL, N acylsphingosine amidohydrolase (acid ceramidase) like; N-acylethanolamine-hydrolyzing acid amidase; ASAH-like protein; acid ceramidase-like protein; PLT; ASAHL
• Gene ID: 27163
• mRNA Refseq: NM_001042402
• Protein Refseq: NP_001035861
• MIM: 607469
• UniProt ID: Q02083
• Chromosome Location: 4q21.1
• Function: hydrolase activity; molecular_function; transcription factor binding