Recombinant Human NAAA, His-tagged

Cat.No. : NAAA-34H
Product Overview : Recombinant Human N-Acylethanolamine-Hydrolyzing Acid Amidase/NAAA is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser29-Glu199) of Human NAAA fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 29-199 a.a.
AA Sequence : SPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQ PFTGEIRGMCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVD VQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDPEVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name NAAA N-acylethanolamine acid amidase [ Homo sapiens ]
Official Symbol NAAA
Synonyms NAAA; N-acylethanolamine acid amidase; ASAHL, N acylsphingosine amidohydrolase (acid ceramidase) like; N-acylethanolamine-hydrolyzing acid amidase; ASAH-like protein; acid ceramidase-like protein; PLT; ASAHL;
Gene ID 27163
mRNA Refseq NM_001042402
Protein Refseq NP_001035861
MIM 607469
UniProt ID Q02083
Chromosome Location 4q21.1
Function hydrolase activity; molecular_function; transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAAA Products

Required fields are marked with *

My Review for All NAAA Products

Required fields are marked with *

0
cart-icon