Recombinant Human NACC1 protein, His-tagged
Cat.No. : | NACC1-1169H |
Product Overview : | Recombinant Human NACC1 protein(173-527 aa), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 173-527 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NACC1 nucleus accumbens associated 1, BEN and BTB (POZ) domain containing [ Homo sapiens ] |
Official Symbol | NACC1 |
Synonyms | NACC1; nucleus accumbens associated 1, BEN and BTB (POZ) domain containing; BTB (POZ) domain containing 14B , BTBD14B; nucleus accumbens-associated protein 1; BEN domain containing 8; BEND8; NAC 1; NAC1; nucleus accumbens associated 1; transcriptional repressor NAC1; BTB/POZ domain-containing protein 14B; NAC-1; BTBD14B; FLJ37383; |
Gene ID | 112939 |
mRNA Refseq | NM_052876.3 |
Protein Refseq | NP_443108.1 |
MIM | 610672 |
UniProt ID | Q96RE7 |
◆ Recombinant Proteins | ||
NACC1-1168H | Recombinant Human NACC1 protein, GST-tagged | +Inquiry |
NACC1-5892M | Recombinant Mouse NACC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NACC1-3886R | Recombinant Rat NACC1 Protein | +Inquiry |
NACC1-3545R | Recombinant Rat NACC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NACC1-10398M | Recombinant Mouse NACC1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NACC1 Products
Required fields are marked with *
My Review for All NACC1 Products
Required fields are marked with *