Recombinant Human NACC1 protein, His-tagged

Cat.No. : NACC1-1169H
Product Overview : Recombinant Human NACC1 protein(173-527 aa), fused to His tag, was expressed in E. coli.
Availability July 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 173-527 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NACC1 nucleus accumbens associated 1, BEN and BTB (POZ) domain containing [ Homo sapiens ]
Official Symbol NACC1
Synonyms NACC1; nucleus accumbens associated 1, BEN and BTB (POZ) domain containing; BTB (POZ) domain containing 14B , BTBD14B; nucleus accumbens-associated protein 1; BEN domain containing 8; BEND8; NAC 1; NAC1; nucleus accumbens associated 1; transcriptional repressor NAC1; BTB/POZ domain-containing protein 14B; NAC-1; BTBD14B; FLJ37383;
Gene ID 112939
mRNA Refseq NM_052876.3
Protein Refseq NP_443108.1
MIM 610672
UniProt ID Q96RE7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NACC1 Products

Required fields are marked with *

My Review for All NACC1 Products

Required fields are marked with *

0
cart-icon