Recombinant Human NACC2 protein, GST-tagged
| Cat.No. : | NACC2-301216H |
| Product Overview : | Recombinant Human NACC2 (241-466 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Tyr241-Tyr466 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | YPQGERTSPGASSLPTTDSPTSYHNEEDEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLELVAGSGVYITRGQLMNCHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLYCQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLPEGVEMY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NACC2 NACC family member 2 [ Homo sapiens (human) ] |
| Official Symbol | NACC2 |
| Synonyms | RBB; BEND9; NAC-2; BTBD14; BTBD31; BTBD14A |
| Gene ID | 138151 |
| mRNA Refseq | NM_144653 |
| Protein Refseq | NP_653254 |
| MIM | 615786 |
| ◆ Recombinant Proteins | ||
| NACC2-2940R | Recombinant Rhesus monkey NACC2 Protein, His-tagged | +Inquiry |
| NACC2-301216H | Recombinant Human NACC2 protein, GST-tagged | +Inquiry |
| NACC2-1659HF | Recombinant Full Length Human NACC2 Protein, GST-tagged | +Inquiry |
| NACC2-2384C | Recombinant Chicken NACC2 | +Inquiry |
| NACC2-3576H | Recombinant Human NACC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NACC2-189HCL | Recombinant Human NACC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NACC2 Products
Required fields are marked with *
My Review for All NACC2 Products
Required fields are marked with *
