Recombinant Human NAGA protein, His-tagged
Cat.No. : | NAGA-3918H |
Product Overview : | Recombinant Human NAGA protein(22-411 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-411 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NAGA N-acetylgalactosaminidase, alpha- [ Homo sapiens ] |
Official Symbol | NAGA |
Synonyms | NAGA; N-acetylgalactosaminidase, alpha-; alpha-N-acetylgalactosaminidase; D22S674; alpha-galactosidase B; Acetylgalactosaminidase, alpha-N- (alpha-galactosidase B); GALB; |
Gene ID | 4668 |
mRNA Refseq | NM_000262 |
Protein Refseq | NP_000253 |
MIM | 104170 |
UniProt ID | P17050 |
◆ Recombinant Proteins | ||
Naga-794M | Recombinant Mouse Naga Protein, His-tagged | +Inquiry |
Naga-796R | Recombinant Rat Naga Protein, His-tagged | +Inquiry |
NAGA-401C | Active Recombinant C. perfringens NAGA, Met&His-tagged | +Inquiry |
NAGA-4138B | Recombinant Bacillus subtilis NAGA protein, His-tagged | +Inquiry |
NAGA-3918H | Recombinant Human NAGA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAGA-3983HCL | Recombinant Human NAGA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAGA Products
Required fields are marked with *
My Review for All NAGA Products
Required fields are marked with *