Recombinant Human NAGA Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NAGA-5419H |
Product Overview : | NAGA MS Standard C13 and N15-labeled recombinant protein (NP_000253) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase, which cleaves alpha-N-acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease). |
Molecular Mass : | 46.6 kDa |
AA Sequence : | MLLKTVLLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NAGA alpha-N-acetylgalactosaminidase [ Homo sapiens (human) ] |
Official Symbol | NAGA |
Synonyms | NAGA; N-acetylgalactosaminidase, alpha-; alpha-N-acetylgalactosaminidase; D22S674; alpha-galactosidase B; Acetylgalactosaminidase, alpha-N- (alpha-galactosidase B); GALB; |
Gene ID | 4668 |
mRNA Refseq | NM_000262 |
Protein Refseq | NP_000253 |
MIM | 104170 |
UniProt ID | P17050 |
◆ Recombinant Proteins | ||
NAGA-344H | Recombinant Human NAGA, His-tagged | +Inquiry |
Naga-796R | Recombinant Rat Naga Protein, His-tagged | +Inquiry |
NAGA-4019C | Recombinant Chicken NAGA | +Inquiry |
NAGA-3918H | Recombinant Human NAGA protein, His-tagged | +Inquiry |
NAGA-792H | Recombinant Human NAGA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAGA-3983HCL | Recombinant Human NAGA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAGA Products
Required fields are marked with *
My Review for All NAGA Products
Required fields are marked with *
0
Inquiry Basket