Recombinant Human NAGLU
Cat.No. : | NAGLU-27921TH |
Product Overview : | Recombinant fragment of Human NAGLU with N-terminal proprietary tag.Mol Wt 36.52 kda inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | This gene encodes an enzyme that degrades heparan sulfate by hydrolysis of terminal N-acetyl-D-glucosamine residues in N-acetyl-alpha-D-glucosaminides. Defects in this gene are the cause of mucopolysaccharidosis type IIIB (MPS-IIIB), also known as Sanfilippo syndrome B. This disease is characterized by the lysosomal accumulation and urinary excretion of heparan sulfate. |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Liver, ovary, peripheral blood leukocytes, testis, prostate, spleen, colon, lung, placenta and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGS |
Gene Name | NAGLU N-acetylglucosaminidase, alpha [ Homo sapiens ] |
Official Symbol | NAGLU |
Synonyms | NAGLU; N-acetylglucosaminidase, alpha; alpha-N-acetylglucosaminidase; NAG; Sanfilippo disease IIIB; |
Gene ID | 4669 |
mRNA Refseq | NM_000263 |
Protein Refseq | NP_000254 |
MIM | 609701 |
Uniprot ID | P54802 |
Chromosome Location | 17q21.2 |
Pathway | Glycosaminoglycan degradation, organism-specific biosystem; Glycosaminoglycan degradation, conserved biosystem; Heparan sulfate degradation, organism-specific biosystem; Heparan sulfate degradation, conserved biosystem; Lysosome, organism-specific biosystem; |
Function | alpha-N-acetylglucosaminidase activity; hydrolase activity, acting on glycosyl bonds; |
◆ Recombinant Proteins | ||
NAGLU-27921TH | Recombinant Human NAGLU | +Inquiry |
Naglu-7907R | Recombinant Rat Naglu protein, His & GST-tagged | +Inquiry |
NAGLU-705H | Recombinant Human NAGLU protein, His-tagged | +Inquiry |
NAGLU-3217M | Recombinant Mouse NAGLU protein, His-tagged | +Inquiry |
NAGLU-4658H | Recombinant Human NAGLU Protein (Val485-Trp743), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAGLU Products
Required fields are marked with *
My Review for All NAGLU Products
Required fields are marked with *
0
Inquiry Basket