Recombinant Human NAGLU

• Cat.No.: NAGLU-27921TH
• Product Overview: Recombinant fragment of Human NAGLU with N-terminal proprietary tag.Mol Wt 36.52 kda inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: This gene encodes an enzyme that degrades heparan sulfate by hydrolysis of terminal N-acetyl-D-glucosamine residues in N-acetyl-alpha-D-glucosaminides. Defects in this gene are the cause of mucopolysaccharidosis type IIIB (MPS-IIIB), also known as Sanfilippo syndrome B. This disease is characterized by the lysosomal accumulation and urinary excretion of heparan sulfate.
• Molecular Weight: 36.520kDa inclusive of tags
• Tissue specificity: Liver, ovary, peripheral blood leukocytes, testis, prostate, spleen, colon, lung, placenta and kidney.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: YQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGS

Gene Information

• Gene Name: NAGLU N-acetylglucosaminidase, alpha [ Homo sapiens ]
• Official Symbol: NAGLU
• Synonyms: NAGLU; N-acetylglucosaminidase, alpha; alpha-N-acetylglucosaminidase; NAG; Sanfilippo disease IIIB
• Gene ID: 4669
• mRNA Refseq: NM_000263
• Protein Refseq: NP_000254
• MIM: 609701
• Uniprot ID: P54802
• Chromosome Location: 17q21.2
• Pathway: Glycosaminoglycan degradation, organism-specific biosystem; Glycosaminoglycan degradation, conserved biosystem; Heparan sulfate degradation, organism-specific biosystem; Heparan sulfate degradation, conserved biosystem; Lysosome, organism-specific biosystem
• Function: alpha-N-acetylglucosaminidase activity; hydrolase activity, acting on glycosyl bonds