Recombinant Human NAIP Protein, GST-tagged

Cat.No. : NAIP-225H
Product Overview : Human BIRC1 partial ORF ( NP_004527, 1294 a.a. - 1403 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This copy of the gene is full length; additional copies with truncations and internal deletions are also present in this region of chromosome 5q13. It is thought that this gene is a modifier of spinal muscular atrophy caused by mutations in a neighboring gene, SMN1. The protein encoded by this gene contains regions of homology to two baculovirus inhibitor of apoptosis proteins, and it is able to suppress apoptosis induced by various signals. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : LENLKLSINHKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPIIQK
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NAIP NLR family, apoptosis inhibitory protein [ Homo sapiens ]
Official Symbol NAIP
Synonyms NAIP; NLR family, apoptosis inhibitory protein; baculoviral IAP repeat containing 1 , BIRC1; baculoviral IAP repeat-containing protein 1; NLR family; BIR domain containing 1; NLRB1; nucleotide binding oligomerization domain; leucine rich repeat and BIR domain containing 1; neuronal apoptosis inhibitory protein; psi neuronal apoptosis inhibitory protein; nucleotide-binding oligomerization domain, leucine rich repeat and BIR domain containing 1; BIRC1; psiNAIP; FLJ18088; FLJ42520; FLJ58811;
Gene ID 4671
mRNA Refseq NM_004536
Protein Refseq NP_004527
MIM 600355
UniProt ID Q13075

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAIP Products

Required fields are marked with *

My Review for All NAIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon