Recombinant Human NAIP Protein, GST-tagged
Cat.No. : | NAIP-225H |
Product Overview : | Human BIRC1 partial ORF ( NP_004527, 1294 a.a. - 1403 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This copy of the gene is full length; additional copies with truncations and internal deletions are also present in this region of chromosome 5q13. It is thought that this gene is a modifier of spinal muscular atrophy caused by mutations in a neighboring gene, SMN1. The protein encoded by this gene contains regions of homology to two baculovirus inhibitor of apoptosis proteins, and it is able to suppress apoptosis induced by various signals. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | LENLKLSINHKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPIIQK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NAIP NLR family, apoptosis inhibitory protein [ Homo sapiens ] |
Official Symbol | NAIP |
Synonyms | NAIP; NLR family, apoptosis inhibitory protein; baculoviral IAP repeat containing 1 , BIRC1; baculoviral IAP repeat-containing protein 1; NLR family; BIR domain containing 1; NLRB1; nucleotide binding oligomerization domain; leucine rich repeat and BIR domain containing 1; neuronal apoptosis inhibitory protein; psi neuronal apoptosis inhibitory protein; nucleotide-binding oligomerization domain, leucine rich repeat and BIR domain containing 1; BIRC1; psiNAIP; FLJ18088; FLJ42520; FLJ58811; |
Gene ID | 4671 |
mRNA Refseq | NM_004536 |
Protein Refseq | NP_004527 |
MIM | 600355 |
UniProt ID | Q13075 |
◆ Recombinant Proteins | ||
NAIP-7078H | Recombinant Human NAIP protein, His & T7-tagged | +Inquiry |
NAIP-4659H | Recombinant Human NAIP Protein (Asn923-Val1148), N-His tagged | +Inquiry |
NAIP-225H | Recombinant Human NAIP Protein, GST-tagged | +Inquiry |
NAIP-1004H | Recombinant Human NAIP Protein (60-345 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAIP Products
Required fields are marked with *
My Review for All NAIP Products
Required fields are marked with *
0
Inquiry Basket