Recombinant Human NANS protein, GST-tagged
| Cat.No. : | NANS-287H |
| Product Overview : | Recombinant Human NANS protein(NP_061819)(1-359 aa), fused with GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-359 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NANS N-acetylneuraminic acid synthase [ Homo sapiens ] |
| Official Symbol | NANS |
| Synonyms | NANS; N-acetylneuraminic acid synthase; sialic acid synthase; SAS; N-acetylneuraminate synthase; sialic acid phosphate synthase; N-acetylneuraminate-9-phosphate synthase; N-acetylneuraminic acid phosphate synthase; |
| Gene ID | 54187 |
| mRNA Refseq | NM_018946 |
| Protein Refseq | NP_061819 |
| MIM | 605202 |
| UniProt ID | Q9NR45 |
| ◆ Recombinant Proteins | ||
| NANS-1816C | Recombinant Chicken NANS | +Inquiry |
| NANS-4947H | Recombinant Human NANS Protein (Met1-Ser359), N-His tagged | +Inquiry |
| NANS-28783TH | Recombinant Human NANS, His-tagged | +Inquiry |
| NANS-1477H | Recombinant Human NANS Protein, His (Fc)-Avi-tagged | +Inquiry |
| Nans-4288M | Recombinant Mouse Nans Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NANS-3979HCL | Recombinant Human NANS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NANS Products
Required fields are marked with *
My Review for All NANS Products
Required fields are marked with *
