Recombinant Human NAPRT1 Protein (229-538 aa), GST-tagged
| Cat.No. : | NAPRT1-677H |
| Product Overview : | Recombinant Human NAPRT1 Protein (229-538 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 229-538 aa |
| Description : | Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 60.2 kDa |
| AA Sequence : | MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | NAPRT1 nicotinate phosphoribosyltransferase domain containing 1 [ Homo sapiens ] |
| Official Symbol | NAPRT1 |
| Synonyms | NAPRT1; PP3856; NAPRTase; |
| Gene ID | 93100 |
| mRNA Refseq | NM_145201 |
| Protein Refseq | NP_660202 |
| MIM | 611552 |
| UniProt ID | Q6XQN6 |
| ◆ Recombinant Proteins | ||
| NAPRT1-10426M | Recombinant Mouse NAPRT1 Protein | +Inquiry |
| NAPRT1-677H | Recombinant Human NAPRT1 Protein (229-538 aa), GST-tagged | +Inquiry |
| NAPRT1-5908M | Recombinant Mouse NAPRT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NAPRT1-5476H | Recombinant Human NAPRT1 protein, His-tagged | +Inquiry |
| NAPRT1-3902R | Recombinant Rat NAPRT1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAPRT1-1165HCL | Recombinant Human NAPRT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAPRT1 Products
Required fields are marked with *
My Review for All NAPRT1 Products
Required fields are marked with *
