Recombinant Human NAPRT1 Protein (229-538 aa), GST-tagged
Cat.No. : | NAPRT1-677H |
Product Overview : | Recombinant Human NAPRT1 Protein (229-538 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 229-538 aa |
Description : | Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 60.2 kDa |
AA Sequence : | MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NAPRT1 nicotinate phosphoribosyltransferase domain containing 1 [ Homo sapiens ] |
Official Symbol | NAPRT1 |
Synonyms | NAPRT1; PP3856; NAPRTase; |
Gene ID | 93100 |
mRNA Refseq | NM_145201 |
Protein Refseq | NP_660202 |
MIM | 611552 |
UniProt ID | Q6XQN6 |
◆ Recombinant Proteins | ||
NAPRT1-5476H | Recombinant Human NAPRT1 protein, His-tagged | +Inquiry |
NAPRT1-7104C | Recombinant Chicken NAPRT1 | +Inquiry |
NAPRT1-3902R | Recombinant Rat NAPRT1 Protein | +Inquiry |
NAPRT1-3561R | Recombinant Rat NAPRT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAPRT1-677H | Recombinant Human NAPRT1 Protein (229-538 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAPRT1-1165HCL | Recombinant Human NAPRT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAPRT1 Products
Required fields are marked with *
My Review for All NAPRT1 Products
Required fields are marked with *