Recombinant Human NAPSA protein, His-tagged
| Cat.No. : | NAPSA-3262H |
| Product Overview : | Recombinant Human NAPSA protein(O96009)(64-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 64-420aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.5 kDa |
| AA Sequence : | KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | NAPSA napsin A aspartic peptidase [ Homo sapiens ] |
| Official Symbol | NAPSA |
| Synonyms | NAPSA; napsin A aspartic peptidase; napsin-A; KAP; Kdap; kidney derived aspartic protease like protein; NAP1; NAPA; ASP4; asp 4; napsin-1; TA01/TA02; pronapsin A; aspartyl protease 4; kidney-derived aspartic protease-like protein; SNAPA; |
| Gene ID | 9476 |
| mRNA Refseq | NM_004851 |
| Protein Refseq | NP_004842 |
| MIM | 605631 |
| UniProt ID | O96009 |
| ◆ Recombinant Proteins | ||
| NAPSA-5909M | Recombinant Mouse NAPSA Protein, His (Fc)-Avi-tagged | +Inquiry |
| NAPSA-10427M | Recombinant Mouse NAPSA Protein | +Inquiry |
| NAPSA-3262H | Recombinant Human NAPSA protein, His-tagged | +Inquiry |
| Napsa-4643M | Recombinant Mouse Napsa protein, His-tagged | +Inquiry |
| NAPSA-1182H | Recombinant Human NAPSA, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAPSA-3969HCL | Recombinant Human NAPSA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAPSA Products
Required fields are marked with *
My Review for All NAPSA Products
Required fields are marked with *



