Recombinant Human NAPSA protein, His-tagged

Cat.No. : NAPSA-3262H
Product Overview : Recombinant Human NAPSA protein(O96009)(64-420aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 64-420aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.5 kDa
AA Sequence : KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name NAPSA napsin A aspartic peptidase [ Homo sapiens ]
Official Symbol NAPSA
Synonyms NAPSA; napsin A aspartic peptidase; napsin-A; KAP; Kdap; kidney derived aspartic protease like protein; NAP1; NAPA; ASP4; asp 4; napsin-1; TA01/TA02; pronapsin A; aspartyl protease 4; kidney-derived aspartic protease-like protein; SNAPA;
Gene ID 9476
mRNA Refseq NM_004851
Protein Refseq NP_004842
MIM 605631
UniProt ID O96009

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAPSA Products

Required fields are marked with *

My Review for All NAPSA Products

Required fields are marked with *

0
cart-icon
0
compare icon