Recombinant Human NARS2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NARS2-5506H |
| Product Overview : | NARS2 MS Standard C13 and N15-labeled recombinant protein (NP_078954) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a putative member of the class II family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of asparagine to tRNA molecules. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency 24 (COXPD24). |
| Molecular Mass : | 54.1 kDa |
| AA Sequence : | MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVLFLHVNDGSSLESLQVVADSGLDSRELTFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGNCDAKDFPIKYKERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NARS2 asparaginyl-tRNA synthetase 2, mitochondrial [ Homo sapiens (human) ] |
| Official Symbol | NARS2 |
| Synonyms | NARS2; asparaginyl-tRNA synthetase 2, mitochondrial (putative); probable asparagine--tRNA ligase, mitochondrial; asparagine tRNA ligase 2; mitochondrial (putative); FLJ23441; SLM5; asparagine--tRNA ligase; asparagine tRNA ligase 2, mitochondrial (putative); probable asparaginyl-tRNA synthetase, mitochondrial; asnRS; |
| Gene ID | 79731 |
| mRNA Refseq | NM_024678 |
| Protein Refseq | NP_078954 |
| MIM | 612803 |
| UniProt ID | Q96I59 |
| ◆ Recombinant Proteins | ||
| NARS2-2110HFL | Recombinant Full Length Human NARS2 Protein, C-Flag-tagged | +Inquiry |
| NARS2-5914M | Recombinant Mouse NARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NARS2-4614Z | Recombinant Zebrafish NARS2 | +Inquiry |
| Nars2-4295M | Recombinant Mouse Nars2 Protein, Myc/DDK-tagged | +Inquiry |
| NARS2-1187H | Recombinant Human NARS2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NARS2-3967HCL | Recombinant Human NARS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NARS2 Products
Required fields are marked with *
My Review for All NARS2 Products
Required fields are marked with *
