Recombinant Human NARS2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NARS2-5506H
Product Overview : NARS2 MS Standard C13 and N15-labeled recombinant protein (NP_078954) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a putative member of the class II family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of asparagine to tRNA molecules. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency 24 (COXPD24).
Molecular Mass : 54.1 kDa
AA Sequence : MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVLFLHVNDGSSLESLQVVADSGLDSRELTFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGNCDAKDFPIKYKERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NARS2 asparaginyl-tRNA synthetase 2, mitochondrial [ Homo sapiens (human) ]
Official Symbol NARS2
Synonyms NARS2; asparaginyl-tRNA synthetase 2, mitochondrial (putative); probable asparagine--tRNA ligase, mitochondrial; asparagine tRNA ligase 2; mitochondrial (putative); FLJ23441; SLM5; asparagine--tRNA ligase; asparagine tRNA ligase 2, mitochondrial (putative); probable asparaginyl-tRNA synthetase, mitochondrial; asnRS;
Gene ID 79731
mRNA Refseq NM_024678
Protein Refseq NP_078954
MIM 612803
UniProt ID Q96I59

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NARS2 Products

Required fields are marked with *

My Review for All NARS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon