Recombinant Human NAT1 protein, His-tagged
Cat.No. : | NAT1-4578H |
Product Overview : | Recombinant Human NAT1 protein(P18440)(1-290 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-290 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 38.0 kDa |
AASequence : | MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | NAT1 N-acetyltransferase 1 (arylamine N-acetyltransferase) [ Homo sapiens ] |
Official Symbol | NAT1 |
Synonyms | NAT1; N-acetyltransferase 1 (arylamine N-acetyltransferase); AAC1; arylamine N-acetyltransferase 1; arylamide acetylase 1; N-acetyltransferase type 1; monomorphic arylamine N-acetyltransferase; MNAT; NATI; NAT-1; |
Gene ID | 9 |
mRNA Refseq | NM_000662 |
Protein Refseq | NP_000653 |
MIM | 108345 |
UniProt ID | P18440 |
◆ Recombinant Proteins | ||
NAT1-138H | Recombinant Human NAT1 Protein, His-tagged | +Inquiry |
NAT1-328HF | Recombinant Full Length Human NAT1 Protein | +Inquiry |
NAT1-3573H | Recombinant Human NAT1, His-tagged | +Inquiry |
Nat1-405M | Recombinant Mouse Nat1 Protein, His-tagged | +Inquiry |
NAT1-5915M | Recombinant Mouse NAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT1-1168HCL | Recombinant Human NAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT1 Products
Required fields are marked with *
My Review for All NAT1 Products
Required fields are marked with *