Recombinant Human NAT1 protein, His-tagged

• Cat.No.: NAT1-4578H
• Product Overview: Recombinant Human NAT1 protein(P18440)(1-290 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-290 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 38.0 kDa
• AASequence: MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: NAT1 N-acetyltransferase 1 (arylamine N-acetyltransferase) [ Homo sapiens ]
• Official Symbol: NAT1
• Synonyms: NAT1; N-acetyltransferase 1 (arylamine N-acetyltransferase); AAC1; arylamine N-acetyltransferase 1; arylamide acetylase 1; N-acetyltransferase type 1; monomorphic arylamine N-acetyltransferase; MNAT; NATI; NAT-1
• Gene ID: 9
• mRNA Refseq: NM_000662
• Protein Refseq: NP_000653
• MIM: 108345
• UniProt ID: P18440