Recombinant Human NAT1
Cat.No. : | NAT1-28863TH |
Product Overview : | Recombinant full length Human NAT1 (amino acids 1-290) with N terminal proprietary tag, 57.97 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 290 amino acids |
Molecular Weight : | 57.970kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENL NIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALT TIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWY LDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIE DFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLV PKHGDRFFTI |
Sequence Similarities : | Belongs to the arylamine N-acetyltransferase family. |
Gene Name : | NAT1 N-acetyltransferase 1 (arylamine N-acetyltransferase) [ Homo sapiens ] |
Official Symbol : | NAT1 |
Synonyms : | NAT1; N-acetyltransferase 1 (arylamine N-acetyltransferase); AAC1; arylamine N-acetyltransferase 1; |
Gene ID : | 9 |
mRNA Refseq : | NM_000662 |
Protein Refseq : | NP_000653 |
MIM : | 108345 |
Uniprot ID : | P18440 |
Chromosome Location : | 8p22 |
Pathway : | Acetylation, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Caffeine metabolism, organism-specific biosystem; Caffeine metabolism, conserved biosystem; Drug metabolism - other enzymes, organism-specific biosystem; |
Function : | acetyltransferase activity; arylamine N-acetyltransferase activity; transferase activity, transferring acyl groups; |
Products Types
◆ Recombinant Protein | ||
NAT1-3565R | Recombinant Rat NAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAT1-5915M | Recombinant Mouse NAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAT1-1817H | Recombinant Human NAT1 Protein, His&GST-tagged | +Inquiry |
Nat1-405M | Recombinant Mouse Nat1 Protein, His-tagged | +Inquiry |
NAT1-2478H | Recombinant Human NAT1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
NAT1-1168HCL | Recombinant Human NAT1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket