Recombinant Human NAT8L protein, GST-tagged
| Cat.No. : | NAT8L-4954H |
| Product Overview : | Human NAT8L full-length ORF ( NP_848652.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 41.5 kDa |
| AA Sequence : | MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | NAT8L N-acetyltransferase 8 like [ Homo sapiens (human) ] |
| Official Symbol | NAT8L |
| Synonyms | CML3; NACED; NAT8-LIKE; NAT8L; FLJ37478 |
| Gene ID | 339983 |
| mRNA Refseq | NM_178557.3 |
| Protein Refseq | NP_848652.2 |
| UniProt ID | Q8N9F0 |
| ◆ Recombinant Proteins | ||
| NAT8L-10441M | Recombinant Mouse NAT8L Protein | +Inquiry |
| NAT8L-5455Z | Recombinant Zebrafish NAT8L | +Inquiry |
| NAT8L-3910R | Recombinant Rat NAT8L Protein | +Inquiry |
| RFL25461DF | Recombinant Full Length Danio Rerio N-Acetylaspartate Synthetase(Nat8L) Protein, His-Tagged | +Inquiry |
| NAT8L-4994H | Recombinant Human NAT8L protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAT8L-3960HCL | Recombinant Human NAT8L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT8L Products
Required fields are marked with *
My Review for All NAT8L Products
Required fields are marked with *
