Recombinant Human NAXE Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NAXE-4564H
Product Overview : APOA1BP MS Standard C13 and N15-labeled recombinant protein (NP_658985) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes.
Molecular Mass : 31.7 kDa
AA Sequence : MSRLRALLGLGLLVAGSRLPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NAXE NAD(P)HX epimerase [ Homo sapiens (human) ]
Official Symbol NAXE
Synonyms NAXE; NAD(P)HX epimerase; AIBP; PEBEL; YJEFN1; APOA1BP; NAD(P)H-hydrate epimerase; AI-BP; apoA-I binding protein; apolipoprotein A-I-binding protein; yjeF N-terminal domain-containing protein 1; yjeF_N1; EC 5.1.99.6
Gene ID 128240
mRNA Refseq NM_144772
Protein Refseq NP_658985
MIM 608862
UniProt ID Q8NCW5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAXE Products

Required fields are marked with *

My Review for All NAXE Products

Required fields are marked with *

0
cart-icon