Recombinant Human NBL1 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | NBL1-150H |
Product Overview : | NBL1 MS Standard C13 and N15-labeled recombinant protein (NP_005371) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants have been identified for this gene. Read-through transcripts between this locus and the upstream mitochondrial inner membrane organizing system 1 gene (GeneID 440574) have been observed. |
Molecular Mass : | 19.3 kDa |
AA Sequence : | MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NBL1 NBL1, DAN family BMP antagonist [ Homo sapiens (human) ] |
Official Symbol | NBL1 |
Synonyms | NBL1; NBL1, DAN family BMP antagonist; D1S1733E; DAN; DAND1; NB; NO3; neuroblastoma suppressor of tumorigenicity 1; DAN domain family member 1; differential screening-selected gene aberrant in neuroblastoma; neuroblastoma 1, DAN family BMP antagonist; neuroblastoma candidate region, suppression of tumorigenicity 1 |
Gene ID | 4681 |
mRNA Refseq | NM_005380 |
Protein Refseq | NP_005371 |
MIM | 600613 |
UniProt ID | P41271 |
◆ Recombinant Proteins | ||
NBL1-11824Z | Recombinant Zebrafish NBL1 | +Inquiry |
NBL1-4461H | Recombinant Human NBL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NBL1-1599H | Recombinant Human Neuroblastoma, Suppression of Tumorigenicity 1 | +Inquiry |
Nbl1-5925M | Recombinant Mouse Nbl1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nbl1-5718M | Recombinant Mouse Nbl1 Protein (Ala17-Asp178), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NBL1-2987HCL | Recombinant Human NBL1 cell lysate | +Inquiry |
NBL1-1627MCL | Recombinant Mouse NBL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NBL1 Products
Required fields are marked with *
My Review for All NBL1 Products
Required fields are marked with *
0
Inquiry Basket