Recombinant Human NBN Protein, His-tagged

• Cat.No.: NBN-2479H
• Product Overview: Recombinant Human NBN protein(Pro498-Arg754), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Pro498-Arg754
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4, 100mM Arginine.
• Molecular Mass: The protein has a calculated MW of 31 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGHHHHHHSGSEFPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR

Gene Information

• Gene Name: NBN nibrin [ Homo sapiens ]
• Official Symbol: NBN
• Synonyms: NBN; nibrin; NBS, NBS1, Nijmegen breakage syndrome 1 (nibrin); AT V1; AT V2; ATV; cell cycle regulatory protein p95; Nijmegen breakage syndrome 1 (nibrin); p95 protein of the MRE11/RAD50 complex; NBS; P95; NBS1; AT-V1; AT-V2; FLJ10155; MGC87362
• Gene ID: 4683
• mRNA Refseq: NM_002485
• Protein Refseq: NP_002476
• MIM: 602667
• UniProt ID: O60934