Recombinant Human NBN Protein, His-tagged

Cat.No. : NBN-2479H
Product Overview : Recombinant Human NBN protein(Pro498-Arg754), fused with N-terminal His tag, was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Pro498-Arg754
Tag : N-His
Form : Liquid in sterile PBS, pH7.4, 100mM Arginine.
Molecular Mass : The protein has a calculated MW of 31 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGHHHHHHSGSEFPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Gene Name NBN nibrin [ Homo sapiens ]
Official Symbol NBN
Synonyms NBN; nibrin; NBS, NBS1, Nijmegen breakage syndrome 1 (nibrin); AT V1; AT V2; ATV; cell cycle regulatory protein p95; Nijmegen breakage syndrome 1 (nibrin); p95 protein of the MRE11/RAD50 complex; NBS; P95; NBS1; AT-V1; AT-V2; FLJ10155; MGC87362;
Gene ID 4683
mRNA Refseq NM_002485
Protein Refseq NP_002476
MIM 602667
UniProt ID O60934

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NBN Products

Required fields are marked with *

My Review for All NBN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon