Recombinant Human NBN Protein, His-tagged
| Cat.No. : | NBN-2479H |
| Product Overview : | Recombinant Human NBN protein(Pro498-Arg754), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | November 26, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Pro498-Arg754 |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4, 100mM Arginine. |
| Molecular Mass : | The protein has a calculated MW of 31 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGHHHHHHSGSEFPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR |
| Gene Name | NBN nibrin [ Homo sapiens ] |
| Official Symbol | NBN |
| Synonyms | NBN; nibrin; NBS, NBS1, Nijmegen breakage syndrome 1 (nibrin); AT V1; AT V2; ATV; cell cycle regulatory protein p95; Nijmegen breakage syndrome 1 (nibrin); p95 protein of the MRE11/RAD50 complex; NBS; P95; NBS1; AT-V1; AT-V2; FLJ10155; MGC87362; |
| Gene ID | 4683 |
| mRNA Refseq | NM_002485 |
| Protein Refseq | NP_002476 |
| MIM | 602667 |
| UniProt ID | O60934 |
| ◆ Recombinant Proteins | ||
| NBN-01H | Recombinant Human NBN Protein, His-tagged | +Inquiry |
| NBN-2951R | Recombinant Rhesus monkey NBN Protein, His-tagged | +Inquiry |
| NBN-2479H | Recombinant Human NBN Protein, His-tagged | +Inquiry |
| NBN-2480H | Recombinant Human NBN Protein, His-tagged | +Inquiry |
| NBN-001H | Recombinant Human NBN Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NBN-3957HCL | Recombinant Human NBN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NBN Products
Required fields are marked with *
My Review for All NBN Products
Required fields are marked with *
