Recombinant Human NCAM1 protein, GST-tagged
Cat.No. : | NCAM1-1209H |
Product Overview : | Recombinant Human NCAM1 protein(30-352 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 30-352 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NCAM1 neural cell adhesion molecule 1 [ Homo sapiens ] |
Official Symbol | NCAM1 |
Synonyms | NCAM1; neural cell adhesion molecule 1; CD56; NCAM; neural cell adhesion molecule, NCAM; antigen recognized by monoclonal 5.1H11; MSK39; |
Gene ID | 4684 |
mRNA Refseq | NM_000615 |
Protein Refseq | NP_000606 |
MIM | 116930 |
UniProt ID | P13591 |
◆ Recombinant Proteins | ||
NCAM1-1209H | Recombinant Human NCAM1 protein, GST-tagged | +Inquiry |
NCAM1-592H | Active Recombinant Human NCAM1 protein, Fc-tagged | +Inquiry |
NCAM1-4665H | Recombinant Human NCAM1 Protein (Leu20-Pro603), C-His tagged | +Inquiry |
Ncam1-685M | Active Recombinant Mouse Ncam1, His-tagged | +Inquiry |
Ncam1-112M | Active Recombinant Mouse Ncam1, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCAM1-858RCL | Recombinant Rat NCAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCAM1 Products
Required fields are marked with *
My Review for All NCAM1 Products
Required fields are marked with *
0
Inquiry Basket