Recombinant Human NCAPG Protein, GST-tagged

Cat.No. : NCAPG-4613H
Product Overview : Human HCAP-G partial ORF ( AAH00827, 336 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 336-435 a.a.
Description : This gene encodes a subunit of the condensin complex, which is responsible for the condensation and stabilization of chromosomes during mitosis and meiosis. Phosphorylation of the encoded protein activates the condensin complex. There are pseudogenes for this gene on chromosomes 8 and 15. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Molecular Mass : 36.63 kDa
AA Sequence : TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NCAPG non-SMC condensin I complex, subunit G [ Homo sapiens ]
Official Symbol NCAPG
Synonyms NCAPG; non-SMC condensin I complex, subunit G; condensin complex subunit 3; CAP G; chromosome condensation protein G; FLJ12450; hCAP G; XCAP-G homolog; condensin subunit CAP-G; melanoma antigen NY-MEL-3; chromosome-associated protein G; CAPG; CHCG; HCAP-G; NY-MEL-3; MGC126525;
Gene ID 64151
mRNA Refseq NM_022346
Protein Refseq NP_071741
MIM 606280
UniProt ID Q9BPX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCAPG Products

Required fields are marked with *

My Review for All NCAPG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon