Recombinant Human NCAPH Protein, GST-tagged

Cat.No. : NCAPH-346H
Product Overview : Human BRRN1 partial ORF ( AAH24211, 645 a.a. - 741 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.30 kDa
AA Sequence : KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NCAPH non-SMC condensin I complex, subunit H [ Homo sapiens ]
Official Symbol NCAPH
Synonyms NCAPH; non-SMC condensin I complex, subunit H; barren (Drosophila) homolog , barren homolog (Drosophila) , barren homolog 1 (Drosophila) , BRRN1; condensin complex subunit 2; CAP H; hCAP H; XCAP-H homolog; barren homolog 1; barren homolog protein 1; chromosome-associated protein H; BRRN1; CAP-H; HCAP-H;
Gene ID 23397
mRNA Refseq NM_015341
Protein Refseq NP_056156
MIM 602332
UniProt ID Q15003

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCAPH Products

Required fields are marked with *

My Review for All NCAPH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon