Recombinant Human NCAPH Protein, GST-tagged
Cat.No. : | NCAPH-346H |
Product Overview : | Human BRRN1 partial ORF ( AAH24211, 645 a.a. - 741 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.30 kDa |
AA Sequence : | KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NCAPH non-SMC condensin I complex, subunit H [ Homo sapiens ] |
Official Symbol | NCAPH |
Synonyms | NCAPH; non-SMC condensin I complex, subunit H; barren (Drosophila) homolog , barren homolog (Drosophila) , barren homolog 1 (Drosophila) , BRRN1; condensin complex subunit 2; CAP H; hCAP H; XCAP-H homolog; barren homolog 1; barren homolog protein 1; chromosome-associated protein H; BRRN1; CAP-H; HCAP-H; |
Gene ID | 23397 |
mRNA Refseq | NM_015341 |
Protein Refseq | NP_056156 |
MIM | 602332 |
UniProt ID | Q15003 |
◆ Recombinant Proteins | ||
NCAPH-5052Z | Recombinant Zebrafish NCAPH | +Inquiry |
NCAPH-346H | Recombinant Human NCAPH Protein, GST-tagged | +Inquiry |
NCAPH-4626C | Recombinant Chicken NCAPH | +Inquiry |
NCAPH-1207H | Recombinant Human NCAPH, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCAPH-3954HCL | Recombinant Human NCAPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCAPH Products
Required fields are marked with *
My Review for All NCAPH Products
Required fields are marked with *
0
Inquiry Basket