Recombinant Human NCCRP1 protein, GST-tagged
Cat.No. : | NCCRP1-3661H |
Product Overview : | Recombinant Human NCCRP1 protein(1-275 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-275 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MEEVREGHALGGGMEADGPASLQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPEPAQPSEAHARQLLLEEWGPLSGGLELPQRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPGVRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NCCRP1 non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) [ Homo sapiens ] |
Official Symbol | NCCRP1 |
Synonyms | NCCRP1; non-specific cytotoxic cell receptor protein 1 homolog (zebrafish); non-specific cytotoxic cell receptor protein 1 homolog; FBXO50; LOC342897; NCCRP 1; nonspecific cytotoxic cell receptor protein 1 homolog; NCCRP-1; |
Gene ID | 342897 |
mRNA Refseq | NM_001001414 |
Protein Refseq | NP_001001414 |
UniProt ID | Q6ZVX7 |
◆ Recombinant Proteins | ||
NCCRP1-3661H | Recombinant Human NCCRP1 protein, GST-tagged | +Inquiry |
NCCRP1-5934M | Recombinant Mouse NCCRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCCRP1-10464M | Recombinant Mouse NCCRP1 Protein | +Inquiry |
NCCRP1-8562Z | Recombinant Zebrafish NCCRP1 | +Inquiry |
NCCRP1-5840N | Recombinant Nile tilapia NCCRP1 Protein (Met1-Pro233), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCCRP1 Products
Required fields are marked with *
My Review for All NCCRP1 Products
Required fields are marked with *
0
Inquiry Basket