Recombinant Human NCF1 protein, GST-tagged
Cat.No. : | NCF1-301532H |
Product Overview : | Recombinant Human NCF1 (31-190 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Lys31-Glu190 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | KWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | NCF1 neutrophil cytosolic factor 1 [ Homo sapiens ] |
Official Symbol | NCF1 |
Synonyms | NCF1; neutrophil cytosolic factor 1; neutrophil cytosolic factor 1 (47kD, chronic granulomatous disease, autosomal 1); neutrophil cytosol factor 1; chronic granulomatous disease; autosomal 1; NADPH oxidase organizer 2; NCF1A; NOXO2; p47phox; SH3PXD1A; NCF-1; NCF-47K; p47-phox; nox organizer 2; nox-organizing protein 2; 47 kDa neutrophil oxidase factor; neutrophil NADPH oxidase factor 1; SH3 and PX domain-containing protein 1A; 47 kDa autosomal chronic granulomatous disease protein; neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1); FLJ79451; |
Gene ID | 653361 |
mRNA Refseq | NM_000265 |
Protein Refseq | NP_000256 |
MIM | 608512 |
UniProt ID | P14598 |
◆ Recombinant Proteins | ||
NCF1-2749H | Recombinant Human Neutrophil Cytosolic Factor 1, His-tagged | +Inquiry |
NCF1-576HFL | Active Recombinant Full Length Human NCF1 Protein, C-Flag-tagged | +Inquiry |
NCF1-3211Z | Recombinant Zebrafish NCF1 | +Inquiry |
NCF1-5937M | Recombinant Mouse NCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCF1-1485H | Recombinant Human NCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCF1-3950HCL | Recombinant Human NCF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCF1 Products
Required fields are marked with *
My Review for All NCF1 Products
Required fields are marked with *