Recombinant Human NCR1 Protein, Fc-tagged

Cat.No. : NCR1-400H
Product Overview : Recombinant human NCR1 protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 304
Description : Predicted to be involved in cellular defense response; regulation of natural killer cell mediated cytotoxicity; and signal transduction. Predicted to act upstream of or within defense response to virus and detection of virus. Predicted to be located in cell surface. Predicted to be part of SWI/SNF complex. Predicted to be active in plasma membrane. Biomarker of acquired immunodeficiency syndrome; anogenital venereal wart; hepatitis C; and lymphoproliferative syndrome.
Form : Lyophilized
Molecular Mass : 53 kDa
AA Sequence : MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name NCR1 natural cytotoxicity triggering receptor 1 [ Homo sapiens (human) ]
Official Symbol NCR1
Synonyms NCR1; natural cytotoxicity triggering receptor 1; LY94, lymphocyte antigen 94 (mouse) homolog (activating NK receptor; NK p46); CD335; NK p46; NKP46; NK cell-activating receptor; natural killer cell p46-related protein; lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46); LY94; NK-p46; FLJ99094;
Gene ID 9437
mRNA Refseq NM_001145457
Protein Refseq NP_001138929
MIM 604530
UniProt ID O76036

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCR1 Products

Required fields are marked with *

My Review for All NCR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon