"NCR3" Related Products

Expand
Expand
Expand

Recombinant Human NCR3 protein, T7/His-tagged

Cat.No.: NCR3-100H
Product Overview: Recombinant human CD337 cDNA (19 – 135 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFLWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGK EVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro non-glycosylated CD337 protein mediated DC or NK cell activations regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD337 protein-protein interaction assay.3. As enzymeatic substrate for vasious proteases.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: NCR3 natural cytotoxicity triggering receptor 3 [ Homo sapiens ]
Official Symbol: NCR3
Synonyms: NCR3; natural cytotoxicity triggering receptor 3; LY117, lymphocyte antigen 117; 1C7; CD337; NKp30; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein; MALS; LY117;
Gene ID: 259197
mRNA Refseq: NM_001145466
Protein Refseq: NP_001138938
MIM: 611550
UniProt ID: O14931
Chromosome Location: 6p21.3
Pathway: Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.