"NCR3" Related Products

Expand
Expand

Recombinant Human NCR3 protein, T7/His-tagged

Cat.No.: NCR3-100H
Product Overview: Recombinant human CD337 cDNA (19 – 135 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFLWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGK EVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro non-glycosylated CD337 protein mediated DC or NK cell activations regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD337 protein-protein interaction assay.3. As enzymeatic substrate for vasious proteases.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: NCR3 natural cytotoxicity triggering receptor 3 [ Homo sapiens ]
Official Symbol: NCR3
Synonyms: NCR3; natural cytotoxicity triggering receptor 3; LY117, lymphocyte antigen 117; 1C7; CD337; NKp30; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein; MALS; LY117;
Gene ID: 259197
mRNA Refseq: NM_001145466
Protein Refseq: NP_001138938
MIM: 611550
UniProt ID: O14931
Chromosome Location: 6p21.3
Pathway: Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.