Recombinant Human NDN
Cat.No. : | NDN-30373TH |
Product Overview : | Recombinant full length Human Necdin with N terminal proprietary tag, 61.38kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 321 amino acids |
Description : | This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. |
Molecular Weight : | 61.380kDa inclusive of tags |
Tissue specificity : | Almost ubiquitous. Detected in fetal brain, lung, liver and kidney; in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Not detected in peripheral blood leuko |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAE PQSPPLGPTAAPQAAPPPQAPNDEGDPKALQQAAEEGRAH QAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIW FPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSL HTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYV KGRGARESAVWNVLRILGLRPWKKHSTFGDVRKLITEEFV QMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLA RVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSE D |
Sequence Similarities : | Contains 1 MAGE domain. |
Gene Name | NDN necdin homolog (mouse) [ Homo sapiens ] |
Official Symbol | NDN |
Synonyms | NDN; necdin homolog (mouse); necdin (mouse) homolog; necdin; HsT16328; PWCR; |
Gene ID | 4692 |
mRNA Refseq | NM_002487 |
Protein Refseq | NP_002478 |
MIM | 602117 |
Uniprot ID | Q99608 |
Chromosome Location | 15q11-q12 |
Pathway | Adipogenesis, organism-specific biosystem; p75(NTR)-mediated signaling, organism-specific biosystem; |
Function | DNA binding; gamma-tubulin binding; |
◆ Recombinant Proteins | ||
NDN-30373TH | Recombinant Human NDN | +Inquiry |
NDN-10498M | Recombinant Mouse NDN Protein | +Inquiry |
NDN-2966R | Recombinant Rhesus monkey NDN Protein, His-tagged | +Inquiry |
NDN-2785R | Recombinant Rhesus Macaque NDN Protein, His (Fc)-Avi-tagged | +Inquiry |
Ndn-4322M | Recombinant Mouse Ndn Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDN-3934HCL | Recombinant Human NDN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDN Products
Required fields are marked with *
My Review for All NDN Products
Required fields are marked with *