Recombinant Human NDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NDRG1-1379H |
Product Overview : | NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_006087) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 42.8 kDa |
AA Sequence : | MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NDRG1 N-myc downstream regulated 1 [ Homo sapiens (human) ] |
Official Symbol | NDRG1 |
Synonyms | NDRG1; N-myc downstream regulated 1; CAP43; protein NDRG1; DRG1; NDR1; RTP; TDD5; DRG-1; protein regulated by oxygen-1; tunicamycin-responsive protein; differentiation-related gene 1 protein; nickel-specific induction protein Cap43; N-myc downstream-regulated gene 1 protein; reducing agents and tunicamycin-responsive protein; GC4; NMSL; CMT4D; HMSNL; RIT42; TARG1; PROXY1; |
Gene ID | 10397 |
mRNA Refseq | NM_006096 |
Protein Refseq | NP_006087 |
MIM | 605262 |
UniProt ID | Q92597 |
◆ Recombinant Proteins | ||
NDRG1-4782H | Recombinant Human NDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NDRG1-1379H | Recombinant Human NDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NDRG1-506H | Recombinant Human NDRG1, His tagged | +Inquiry |
NDRG1-3021H | Recombinant Human NDRG1 protein | +Inquiry |
NDRG1-30371TH | Recombinant Human NDRG1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDRG1-3931HCL | Recombinant Human NDRG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDRG1 Products
Required fields are marked with *
My Review for All NDRG1 Products
Required fields are marked with *