Recombinant Human NDST1

• Cat.No.: NDST1-28794TH
• Product Overview: Recombinant fragment of Human NDST1 with an N terminal proprietary tag; Predicted MWt 36.52 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Molecular Weight: 36.520kDa inclusive of tags
• Tissue specificity: Widely expressed. Expression is most abundant in heart, liver and pancreas.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI
• Sequence Similarities: Belongs to the sulfotransferase 1 family. NDST subfamily.

Gene Information

• Gene Name: NDST1 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 [ Homo sapiens ]
• Official Symbol: NDST1
• Synonyms: NDST1; N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1; HSST; bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1; NST1
• Gene ID: 3340
• mRNA Refseq: NM_001543
• Protein Refseq: NP_001534
• MIM: 600853
• Uniprot ID: P52848
• Chromosome Location: 5q33.1
• Pathway: Glycosaminoglycan biosynthesis - heparan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - heparan sulfate, conserved biosystem; Glycosaminoglycan biosynthesis, heparan sulfate backbone, organism-specific biosystem; Glycosaminoglycan biosynthesis, heparan sulfate backbone, conserved biosystem; Metabolic pathways, organism-specific biosystem
• Function: [heparan sulfate]-glucosamine N-sulfotransferase activity; hydrolase activity; sulfotransferase activity; transferase activity