Recombinant Human NDST1
| Cat.No. : | NDST1-28794TH |
| Product Overview : | Recombinant fragment of Human NDST1 with an N terminal proprietary tag; Predicted MWt 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Tissue specificity : | Widely expressed. Expression is most abundant in heart, liver and pancreas. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI |
| Sequence Similarities : | Belongs to the sulfotransferase 1 family. NDST subfamily. |
| Gene Name | NDST1 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 [ Homo sapiens ] |
| Official Symbol | NDST1 |
| Synonyms | NDST1; N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1; HSST; bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1; NST1; |
| Gene ID | 3340 |
| mRNA Refseq | NM_001543 |
| Protein Refseq | NP_001534 |
| MIM | 600853 |
| Uniprot ID | P52848 |
| Chromosome Location | 5q33.1 |
| Pathway | Glycosaminoglycan biosynthesis - heparan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - heparan sulfate, conserved biosystem; Glycosaminoglycan biosynthesis, heparan sulfate backbone, organism-specific biosystem; Glycosaminoglycan biosynthesis, heparan sulfate backbone, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | [heparan sulfate]-glucosamine N-sulfotransferase activity; hydrolase activity; sulfotransferase activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| NDST1-3590R | Recombinant Rat NDST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NDST1-3932R | Recombinant Rat NDST1 Protein | +Inquiry |
| NDST1-2789R | Recombinant Rhesus Macaque NDST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NDST1-28794TH | Recombinant Human NDST1 | +Inquiry |
| NDST1-2970R | Recombinant Rhesus monkey NDST1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDST1-435HCL | Recombinant Human NDST1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDST1 Products
Required fields are marked with *
My Review for All NDST1 Products
Required fields are marked with *



