Recombinant Human NDST1
Cat.No. : | NDST1-28794TH |
Product Overview : | Recombinant fragment of Human NDST1 with an N terminal proprietary tag; Predicted MWt 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Widely expressed. Expression is most abundant in heart, liver and pancreas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI |
Sequence Similarities : | Belongs to the sulfotransferase 1 family. NDST subfamily. |
Gene Name | NDST1 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 [ Homo sapiens ] |
Official Symbol | NDST1 |
Synonyms | NDST1; N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1; HSST; bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1; NST1; |
Gene ID | 3340 |
mRNA Refseq | NM_001543 |
Protein Refseq | NP_001534 |
MIM | 600853 |
Uniprot ID | P52848 |
Chromosome Location | 5q33.1 |
Pathway | Glycosaminoglycan biosynthesis - heparan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - heparan sulfate, conserved biosystem; Glycosaminoglycan biosynthesis, heparan sulfate backbone, organism-specific biosystem; Glycosaminoglycan biosynthesis, heparan sulfate backbone, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | [heparan sulfate]-glucosamine N-sulfotransferase activity; hydrolase activity; sulfotransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
NDST1-3590R | Recombinant Rat NDST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDST1-2789R | Recombinant Rhesus Macaque NDST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDST1-611HFL | Recombinant Full Length Human NDST1 Protein, C-Flag-tagged | +Inquiry |
NDST1-1492H | Recombinant Human NDST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ndst1-1194M | Recombinant Mouse Ndst1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDST1-435HCL | Recombinant Human NDST1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDST1 Products
Required fields are marked with *
My Review for All NDST1 Products
Required fields are marked with *