Recombinant Human NDST2 protein, His-tagged
Cat.No. : | NDST2-3563H |
Product Overview : | Recombinant Human NDST2 protein(583-883 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 583-883 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NPCDDKRHKDIWSKEKTCDRLPKFLIVGPQKTGTTAIHFFLSLHPAVTSSFPSPSTFEEIQFFNSPNYHKGIDWYMDFFPVPSNASTDFLFEKSATYFDSEVVPRRGAALLPRAKIITVLTNPADRAYSWYQHQRAHGDPVALNYTFYQVISASSQTPLALRSLQNRCLVPGYYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESIQKFLGITPFLNYTRTLRFDDDKGFWCQGLEGGKTRCLGRSKGRRYPDMDTESRLFLTDFFRNHNLELSKLLSRLGQPVPSWLREELQHSSLG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NDST2 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2 [ Homo sapiens (human) ] |
Official Symbol | NDST2 |
Synonyms | NDST2; NST2; HSST2; N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2; bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2; NDST-2; N-HSST 2; N-heparan sulfate sulfotransferase 2; glucosaminyl N-deacetylase/N-sulfotransferase 2; EC 2.8.2.8 |
Gene ID | 8509 |
mRNA Refseq | NM_003635 |
Protein Refseq | NP_003626 |
MIM | 603268 |
UniProt ID | P52849 |
◆ Recombinant Proteins | ||
Ndst2-8321M | Recombinant Mouse Ndst2 protein, His&Myc-tagged | +Inquiry |
NDST2-1221H | Recombinant Human NDST2, GST-tagged | +Inquiry |
NDST2-3596H | Recombinant Human NDST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDST2-3563H | Recombinant Human NDST2 protein, His-tagged | +Inquiry |
NDST2-633H | Recombinant Human NDST2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDST2 Products
Required fields are marked with *
My Review for All NDST2 Products
Required fields are marked with *
0
Inquiry Basket