Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human NDUFA10, His-tagged

Cat.No. : NDUFA10-28707TH
Product Overview : Recombinant fragment, corresponding to amino acids 171-355 of Human NDUFA10 with N terminal His tag; MWt 24kDa;
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene belongs to the complex I 42kDA subunit family. Mammalian complex I is the first enzyme complex in the electron transport chain of mitochondria. It is composed of 45 different subunits. This protein is a component of the hydrophobic protein fraction and has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 65 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVP VPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPE MSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQ DNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDR VLHQFRELPGRKYSPGYNTEVGDKWIWLK
Gene Name : NDUFA10 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa [ Homo sapiens ]
Official Symbol : NDUFA10
Synonyms : NDUFA10; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10 (42kD); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial; CI 42k; complex I 42kDa subunit;
Gene ID : 4705
mRNA Refseq : NM_004544
Protein Refseq : NP_004535
MIM : 603835
Uniprot ID : O95299
Chromosome Location : 2q37.3
Pathway : Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function : ATP binding; NADH dehydrogenase (ubiquinone) activity; phosphotransferase activity, alcohol group as acceptor;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends