Recombinant Human NDUFA10, His-tagged
Cat.No. : | NDUFA10-28707TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 171-355 of Human NDUFA10 with N terminal His tag; MWt 24kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 171-355 a.a. |
Description : | The protein encoded by this gene belongs to the complex I 42kDA subunit family. Mammalian complex I is the first enzyme complex in the electron transport chain of mitochondria. It is composed of 45 different subunits. This protein is a component of the hydrophobic protein fraction and has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 65 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVP VPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPE MSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQ DNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDR VLHQFRELPGRKYSPGYNTEVGDKWIWLK |
Gene Name | NDUFA10 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa [ Homo sapiens ] |
Official Symbol | NDUFA10 |
Synonyms | NDUFA10; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10 (42kD); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial; CI 42k; complex I 42kDa subunit; |
Gene ID | 4705 |
mRNA Refseq | NM_004544 |
Protein Refseq | NP_004535 |
MIM | 603835 |
Uniprot ID | O95299 |
Chromosome Location | 2q37.3 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function | ATP binding; NADH dehydrogenase (ubiquinone) activity; phosphotransferase activity, alcohol group as acceptor; |
◆ Recombinant Proteins | ||
NDUFA10-9981Z | Recombinant Zebrafish NDUFA10 | +Inquiry |
NDUFA10-5963M | Recombinant Mouse NDUFA10 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFA10-3591R | Recombinant Rat NDUFA10 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFA10-28707TH | Recombinant Human NDUFA10, His-tagged | +Inquiry |
NDUFA10-3933R | Recombinant Rat NDUFA10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA10-3925HCL | Recombinant Human NDUFA10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA10 Products
Required fields are marked with *
My Review for All NDUFA10 Products
Required fields are marked with *