Recombinant Human NDUFA13 protein, His-tagged

• Cat.No.: NDUFA13-2538H
• Product Overview: Recombinant Human NDUFA13 protein(1-144 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-144 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: NDUFA13 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 [ Homo sapiens ]
• Official Symbol: NDUFA13
• Synonyms: NDUFA13; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; B16.6; CDA016; CGI 39; complex I B16.6 subunit; GRIM 19; GRIM19; CI-B16.6; complex I-B16.6; cell death-regulatory protein GRIM19; cell death regulatory protein GRIM-19; NADH-ubiquinone oxidoreductase B16.6 subunit; gene associated with retinoic and IFN-induced mortality 19 protein; gene associated with retinoic and interferon-induced mortality 19 protein; CGI-39; GRIM-19; FLJ58045; FLJ59191
• Gene ID: 51079
• mRNA Refseq: NM_015965
• Protein Refseq: NP_057049
• MIM: 609435
• UniProt ID: Q9P0J0