Recombinant Human NDUFA13 protein, His-tagged

Cat.No. : NDUFA13-2538H
Product Overview : Recombinant Human NDUFA13 protein(1-144 aa), fused to His tag, was expressed in E. coli.
Availability November 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-144 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NDUFA13 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 [ Homo sapiens ]
Official Symbol NDUFA13
Synonyms NDUFA13; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; B16.6; CDA016; CGI 39; complex I B16.6 subunit; GRIM 19; GRIM19; CI-B16.6; complex I-B16.6; cell death-regulatory protein GRIM19; cell death regulatory protein GRIM-19; NADH-ubiquinone oxidoreductase B16.6 subunit; gene associated with retinoic and IFN-induced mortality 19 protein; gene associated with retinoic and interferon-induced mortality 19 protein; CGI-39; GRIM-19; FLJ58045; FLJ59191;
Gene ID 51079
mRNA Refseq NM_015965
Protein Refseq NP_057049
MIM 609435
UniProt ID Q9P0J0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFA13 Products

Required fields are marked with *

My Review for All NDUFA13 Products

Required fields are marked with *

0
cart-icon
0
compare icon