Recombinant Human NDUFA13 protein, His-tagged
Cat.No. : | NDUFA13-2538H |
Product Overview : | Recombinant Human NDUFA13 protein(1-144 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-144 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NDUFA13 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 [ Homo sapiens ] |
Official Symbol | NDUFA13 |
Synonyms | NDUFA13; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; B16.6; CDA016; CGI 39; complex I B16.6 subunit; GRIM 19; GRIM19; CI-B16.6; complex I-B16.6; cell death-regulatory protein GRIM19; cell death regulatory protein GRIM-19; NADH-ubiquinone oxidoreductase B16.6 subunit; gene associated with retinoic and IFN-induced mortality 19 protein; gene associated with retinoic and interferon-induced mortality 19 protein; CGI-39; GRIM-19; FLJ58045; FLJ59191; |
Gene ID | 51079 |
mRNA Refseq | NM_015965 |
Protein Refseq | NP_057049 |
MIM | 609435 |
UniProt ID | Q9P0J0 |
◆ Cell & Tissue Lysates | ||
NDUFA13-3922HCL | Recombinant Human NDUFA13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA13 Products
Required fields are marked with *
My Review for All NDUFA13 Products
Required fields are marked with *
0
Inquiry Basket