Recombinant Human NDUFA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NDUFA2-2194H
Product Overview : NDUFA2 MS Standard C13 and N15-labeled recombinant protein (NP_002479) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex 1), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane, and may be involved in regulating complex I activity or its assembly via assistance in redox processes. Mutations in this gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder. Alternative splicing results in multiple transcript variants.
Molecular Mass : 10.9 kDa
AA Sequence : MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NDUFA2 NADH:ubiquinone oxidoreductase subunit A2 [ Homo sapiens (human) ]
Official Symbol NDUFA2
Synonyms NDUFA2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; B8; complex I B8 subunit; NADH-ubiquinone oxidoreductase subunit CI-B8; CD14; CIB8;
Gene ID 4695
mRNA Refseq NM_002488
Protein Refseq NP_002479
MIM 602137
UniProt ID O43678

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFA2 Products

Required fields are marked with *

My Review for All NDUFA2 Products

Required fields are marked with *

0
cart-icon