Recombinant Human NDUFA2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NDUFA2-2194H |
| Product Overview : | NDUFA2 MS Standard C13 and N15-labeled recombinant protein (NP_002479) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex 1), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane, and may be involved in regulating complex I activity or its assembly via assistance in redox processes. Mutations in this gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 10.9 kDa |
| AA Sequence : | MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NDUFA2 NADH:ubiquinone oxidoreductase subunit A2 [ Homo sapiens (human) ] |
| Official Symbol | NDUFA2 |
| Synonyms | NDUFA2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; B8; complex I B8 subunit; NADH-ubiquinone oxidoreductase subunit CI-B8; CD14; CIB8; |
| Gene ID | 4695 |
| mRNA Refseq | NM_002488 |
| Protein Refseq | NP_002479 |
| MIM | 602137 |
| UniProt ID | O43678 |
| ◆ Recombinant Proteins | ||
| NDUFA2-2974R | Recombinant Rhesus monkey NDUFA2 Protein, His-tagged | +Inquiry |
| NDUFA2-5620C | Recombinant Chicken NDUFA2 | +Inquiry |
| NDUFA2-10515M | Recombinant Mouse NDUFA2 Protein | +Inquiry |
| NDUFA2-733C | Recombinant Cynomolgus NDUFA2 Protein, His-tagged | +Inquiry |
| NDUFA2-7202H | Recombinant Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDUFA2-3921HCL | Recombinant Human NDUFA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA2 Products
Required fields are marked with *
My Review for All NDUFA2 Products
Required fields are marked with *
