Recombinant Human NDUFA4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NDUFA4-2135H |
Product Overview : | NDUFA4 MS Standard C13 and N15-labeled recombinant protein (NP_002480) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
Molecular Mass : | 9.4 kDa |
AA Sequence : | MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NDUFA4 NDUFA4 mitochondrial complex associated [ Homo sapiens (human) ] |
Official Symbol | NDUFA4 |
Synonyms | NDUFA4; NDUFA4 mitochondrial complex associated; MLRQ; CI-9k; COXFA4; CI-MLRQ; MC4DN21; cytochrome c oxidase subunit NDUFA4; Complex I 9kDa subunit; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4; NADH-ubiquinone oxidoreductase MLRQ subunit; complex I-MLRQ; cytochrome c oxidase subunit FA4; EC 1.6.99.3; EC 7.1.1.2 |
Gene ID | 4697 |
mRNA Refseq | NM_002489 |
Protein Refseq | NP_002480 |
MIM | 603833 |
UniProt ID | O00483 |
◆ Recombinant Proteins | ||
NDUFA4-666H | Recombinant Human NDUFA4 | +Inquiry |
NDUFA4-3598H | Recombinant Human NDUFA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFA4-12265Z | Recombinant Zebrafish NDUFA4 | +Inquiry |
NDUFA4-2975R | Recombinant Rhesus monkey NDUFA4 Protein, His-tagged | +Inquiry |
NDUFA4-10517M | Recombinant Mouse NDUFA4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA4-3919HCL | Recombinant Human NDUFA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFA4 Products
Required fields are marked with *
My Review for All NDUFA4 Products
Required fields are marked with *
0
Inquiry Basket