Recombinant Human NDUFA4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NDUFA4-2135H
Product Overview : NDUFA4 MS Standard C13 and N15-labeled recombinant protein (NP_002480) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Molecular Mass : 9.4 kDa
AA Sequence : MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NDUFA4 NDUFA4 mitochondrial complex associated [ Homo sapiens (human) ]
Official Symbol NDUFA4
Synonyms NDUFA4; NDUFA4 mitochondrial complex associated; MLRQ; CI-9k; COXFA4; CI-MLRQ; MC4DN21; cytochrome c oxidase subunit NDUFA4; Complex I 9kDa subunit; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4; NADH-ubiquinone oxidoreductase MLRQ subunit; complex I-MLRQ; cytochrome c oxidase subunit FA4; EC 1.6.99.3; EC 7.1.1.2
Gene ID 4697
mRNA Refseq NM_002489
Protein Refseq NP_002480
MIM 603833
UniProt ID O00483

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFA4 Products

Required fields are marked with *

My Review for All NDUFA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon