Recombinant Human NDUFA4L2 protein, GST-tagged
| Cat.No. : | NDUFA4L2-3640H |
| Product Overview : | Recombinant Human NDUFA4L2 protein(1-87 aa), fused to GST tag, was expressed in E. coli. |
| Availability | November 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-87 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NDUFA4L2 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 [ Homo sapiens ] |
| Official Symbol | NDUFA4L2 |
| Synonyms | NDUFA4L2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2; FLJ26118; NUOMS; NADH-ubiquinone oxidoreductase MLRQ subunit homolog; NADH:ubiquinone oxidoreductase MLRQ subunit homolog; |
| Gene ID | 56901 |
| mRNA Refseq | NM_020142 |
| Protein Refseq | NP_064527 |
| UniProt ID | Q9NRX3 |
| ◆ Recombinant Proteins | ||
| NDUFA4L2-10518M | Recombinant Mouse NDUFA4L2 Protein | +Inquiry |
| NDUFA4L2-5969M | Recombinant Mouse NDUFA4L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NDUFA4L2-137H | Recombinant Human NDUFA4L2 Protein, His-tagged | +Inquiry |
| NDUFA4L2-1224H | Recombinant Human NDUFA4L2, GST-tagged | +Inquiry |
| NDUFA4L2-3640H | Recombinant Human NDUFA4L2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDUFA4L2-3918HCL | Recombinant Human NDUFA4L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA4L2 Products
Required fields are marked with *
My Review for All NDUFA4L2 Products
Required fields are marked with *
