Recombinant Human NDUFA6 Protein (27-154 aa), GST-tagged
Cat.No. : | NDUFA6-679H |
Product Overview : | Recombinant Human NDUFA6 Protein (27-154 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 27-154 aa |
Description : | Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 42.1 kDa |
AA Sequence : | MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NDUFA6 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6, 14kDa [ Homo sapiens ] |
Official Symbol | NDUFA6 |
Synonyms | NDUFA6; B14; CI B14; LYRM6; NADHB14; Complex I-B14; CI-B14; |
Gene ID | 4700 |
mRNA Refseq | NM_002490 |
Protein Refseq | NP_002481 |
MIM | 602138 |
UniProt ID | P56556 |
◆ Recombinant Proteins | ||
NDUFA6-5971M | Recombinant Mouse NDUFA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFA6-679H | Recombinant Human NDUFA6 Protein (27-154 aa), GST-tagged | +Inquiry |
NDUFA6-10520M | Recombinant Mouse NDUFA6 Protein | +Inquiry |
NDUFA6-5372C | Recombinant Chicken NDUFA6 | +Inquiry |
NDUFA6-11203Z | Recombinant Zebrafish NDUFA6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA6 Products
Required fields are marked with *
My Review for All NDUFA6 Products
Required fields are marked with *
0
Inquiry Basket