Recombinant Human NDUFA9
Cat.No. : | NDUFA9-28706TH |
Product Overview : | Recombinant full length Human NDUFA9 with N terminal proprietary tag, 69.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 377 amino acids |
Description : | The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12. |
Molecular Weight : | 69.500kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHAL MPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQV IIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAG VEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAII VKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV YVVDVSKGIVNAVKD |
Sequence Similarities : | Belongs to the complex I NDUFA9 subunit family. |
Gene Name | NDUFA9 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa [ Homo sapiens ] |
Official Symbol | NDUFA9 |
Synonyms | NDUFA9; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD) , NDUFS2L; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial; CI 39k; complex I 39kDa subunit; SDR |
Gene ID | 4704 |
mRNA Refseq | NM_005002 |
Protein Refseq | NP_004993 |
MIM | 603834 |
Uniprot ID | Q16795 |
Chromosome Location | 12p13.3 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function | NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; NADH dehydrogenase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
NDUFA9-1227H | Recombinant Human NDUFA9, GST-tagged | +Inquiry |
NDUFA9-3595R | Recombinant Rat NDUFA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ndufa9-4333M | Recombinant Mouse Ndufa9 Protein, Myc/DDK-tagged | +Inquiry |
NDUFA9-10523M | Recombinant Mouse NDUFA9 Protein | +Inquiry |
NDUFA9-1809H | Recombinant Human NDUFA9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA9-3914HCL | Recombinant Human NDUFA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFA9 Products
Required fields are marked with *
My Review for All NDUFA9 Products
Required fields are marked with *
0
Inquiry Basket