Recombinant Full Length Human NDUFA9 Protein
| Cat.No. : | NDUFA9-334HF |
| Product Overview : | Recombinant full length Human NDUFA9 with N terminal proprietary tag, 69.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 377 amino acids |
| Description : | The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12. |
| Form : | Liquid |
| Molecular Mass : | 69.500kDa inclusive of tags |
| AA Sequence : | MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHAL MPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQV IIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAG VEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAII VKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV YVVDVSKGIVNAVKD |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | NDUFA9 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa [ Homo sapiens ] |
| Official Symbol | NDUFA9 |
| Synonyms | NDUFA9; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD) , NDUFS2L; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial; CI 39k; complex I 39kDa subunit; SDR |
| Gene ID | 4704 |
| mRNA Refseq | NM_005002 |
| Protein Refseq | NP_004993 |
| MIM | 603834 |
| UniProt ID | Q16795 |
| ◆ Recombinant Proteins | ||
| NDUFA9-28709TH | Recombinant Human NDUFA9 | +Inquiry |
| NDUFA9-3937R | Recombinant Rat NDUFA9 Protein | +Inquiry |
| NDUFA9-130H | Recombinant Human NDUFA9 Protein, His-tagged | +Inquiry |
| NDUFA9-10523M | Recombinant Mouse NDUFA9 Protein | +Inquiry |
| NDUFA9-5974M | Recombinant Mouse NDUFA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDUFA9-3914HCL | Recombinant Human NDUFA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA9 Products
Required fields are marked with *
My Review for All NDUFA9 Products
Required fields are marked with *
