Recombinant Human NDUFB10 protein, GST-tagged
Cat.No. : | NDUFB10-3269H |
Product Overview : | Recombinant Human NDUFB10 protein(O96000)(1-172aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-172aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.8 kDa |
AA Sequence : | MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NDUFB10 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa [ Homo sapiens ] |
Official Symbol | NDUFB10 |
Synonyms | NDUFB10; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10; complex I PDSW subunit; PDSW; CI-PDSW; complex I-PDSW; NADH-ubiquinone oxidoreductase PDSW subunit; NADH ubiquinone oxidoreductase PDSW subunit (RH 16p13.3); |
Gene ID | 4716 |
mRNA Refseq | NM_004548 |
Protein Refseq | NP_004539 |
MIM | 603843 |
UniProt ID | O96000 |
◆ Recombinant Proteins | ||
NDUFB10-10529M | Recombinant Mouse NDUFB10 Protein | +Inquiry |
NDUFB10-10993Z | Recombinant Zebrafish NDUFB10 | +Inquiry |
NDUFB10-28708TH | Recombinant Human NDUFB10, His-tagged | +Inquiry |
NDUFB10-131H | Recombinant Human NDUFB10 Protein, His-tagged | +Inquiry |
NDUFB10-3269H | Recombinant Human NDUFB10 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFB10-3909HCL | Recombinant Human NDUFB10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFB10 Products
Required fields are marked with *
My Review for All NDUFB10 Products
Required fields are marked with *