Recombinant Human NDUFB10, His-tagged
Cat.No. : | NDUFB10-28708TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-172 of Human NDUFB10 with N terminal His tag. Predicted mwt: 22 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-172 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 68 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVT LVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMC MYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQ QNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQR MLQERKAAKEAAAATS |
Sequence Similarities : | Belongs to the complex I NDUFB10 subunit family. |
Full Length : | Full L. |
Gene Name | NDUFB10 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa [ Homo sapiens ] |
Official Symbol | NDUFB10 |
Synonyms | NDUFB10; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10; complex I PDSW subunit; PDSW; |
Gene ID | 4716 |
mRNA Refseq | NM_004548 |
Protein Refseq | NP_004539 |
MIM | 603843 |
Uniprot ID | O96000 |
Chromosome Location | 16p13.3 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function | NADH dehydrogenase (ubiquinone) activity; protein binding; |
◆ Recombinant Proteins | ||
NDUFB10-3269H | Recombinant Human NDUFB10 protein, GST-tagged | +Inquiry |
NDUFB10-131H | Recombinant Human NDUFB10 Protein, His-tagged | +Inquiry |
NDUFB10-10993Z | Recombinant Zebrafish NDUFB10 | +Inquiry |
NDUFB10-10529M | Recombinant Mouse NDUFB10 Protein | +Inquiry |
NDUFB10-28708TH | Recombinant Human NDUFB10, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFB10-3909HCL | Recombinant Human NDUFB10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFB10 Products
Required fields are marked with *
My Review for All NDUFB10 Products
Required fields are marked with *