Recombinant Human NDUFS5 protein, GST-tagged

• Cat.No.: NDUFS5-4633H
• Product Overview: Recombinant Human NDUFS5 protein(1-106 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-106 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NDUFS5 NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase) [ Homo sapiens ]
• Official Symbol: NDUFS5
• Synonyms: NDUFS5; NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe S protein 5 (15kD) (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 5; CI 15k; complex I 51kDa subunit; NADH dehydrogenase [ubiquinone] iron sulfur protein 5; CI-15 kDa; complex I-15 kDa; NADH:ubiquinone oxidoreductase 15 kDa IP subunit; CI15K; CI-15k
• Gene ID: 4725
• mRNA Refseq: NM_001184979
• Protein Refseq: NP_001171908
• MIM: 603847
• UniProt ID: O43920