Recombinant Human NDUFS6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NDUFS6-2795H
Product Overview : NDUFS6 MS Standard C13 and N15-labeled recombinant protein (NP_004544) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a subunit of the NADH:ubiquinone oxidoreductase (complex I), which is the first enzyme complex in the electron transport chain of mitochondria. This complex functions in the transfer of electrons from NADH to the respiratory chain. The subunit encoded by this gene is one of seven subunits in the iron-sulfur protein fraction. Mutations in this gene cause mitochondrial complex I deficiency, a disease that causes a wide variety of clinical disorders, including neonatal disease and adult-onset neurodegenerative disorders.
Molecular Mass : 13.7 kDa
AA Sequence : MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NDUFS6 NADH:ubiquinone oxidoreductase subunit S6 [ Homo sapiens (human) ]
Official Symbol NDUFS6
Synonyms NDUFS6; NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe S protein 6 (13kD) (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial; CI 13kA; complex I 13kDa subunit A; NADH dehydrogenase [ubiquinone] iron sulfur protein 6; mitochondrial; NADH:ubiquinone oxidoreductase NDUFS6 subunit; NADH-ubiquinone oxidoreductase 13 kDa-A subunit; complex I, mitochondrial respiratory chain, 13-kD subunit; CI-13kA; CI13KDA; CI-13kD-A;
Gene ID 4726
mRNA Refseq NM_004553
Protein Refseq NP_004544
MIM 603848
UniProt ID O75380

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFS6 Products

Required fields are marked with *

My Review for All NDUFS6 Products

Required fields are marked with *

0
cart-icon
0
compare icon