Recombinant Human NDUFS6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NDUFS6-2795H |
Product Overview : | NDUFS6 MS Standard C13 and N15-labeled recombinant protein (NP_004544) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a subunit of the NADH:ubiquinone oxidoreductase (complex I), which is the first enzyme complex in the electron transport chain of mitochondria. This complex functions in the transfer of electrons from NADH to the respiratory chain. The subunit encoded by this gene is one of seven subunits in the iron-sulfur protein fraction. Mutations in this gene cause mitochondrial complex I deficiency, a disease that causes a wide variety of clinical disorders, including neonatal disease and adult-onset neurodegenerative disorders. |
Molecular Mass : | 13.7 kDa |
AA Sequence : | MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NDUFS6 NADH:ubiquinone oxidoreductase subunit S6 [ Homo sapiens (human) ] |
Official Symbol | NDUFS6 |
Synonyms | NDUFS6; NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe S protein 6 (13kD) (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial; CI 13kA; complex I 13kDa subunit A; NADH dehydrogenase [ubiquinone] iron sulfur protein 6; mitochondrial; NADH:ubiquinone oxidoreductase NDUFS6 subunit; NADH-ubiquinone oxidoreductase 13 kDa-A subunit; complex I, mitochondrial respiratory chain, 13-kD subunit; CI-13kA; CI13KDA; CI-13kD-A; |
Gene ID | 4726 |
mRNA Refseq | NM_004553 |
Protein Refseq | NP_004544 |
MIM | 603848 |
UniProt ID | O75380 |
◆ Recombinant Proteins | ||
NDUFS6-1242H | Recombinant Human NDUFS6, GST-tagged | +Inquiry |
NDUFS6-5992M | Recombinant Mouse NDUFS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFS6-10546M | Recombinant Mouse NDUFS6 Protein | +Inquiry |
NDUFS6-2795H | Recombinant Human NDUFS6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NDUFS6-2990R | Recombinant Rhesus monkey NDUFS6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFS6-1179HCL | Recombinant Human NDUFS6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFS6 Products
Required fields are marked with *
My Review for All NDUFS6 Products
Required fields are marked with *
0
Inquiry Basket