Recombinant Human NEK1
| Cat.No. : | NEK1-29277TH |
| Product Overview : | Recombinant fragment of Human NEK1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is a serine/threonine kinase involved in cell cycle regulation. The encoded protein is found in a centrosomal complex with FEZ1, a neuronal protein that plays a role in axonal development. Defects in this gene are a cause of polycystic kidney disease (PKD). Several transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | High fetal expression in the brain and kidney. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVRQD |
| Sequence Similarities : | Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.Contains 1 protein kinase domain. |
| Gene Name | NEK1 NIMA (never in mitosis gene a)-related kinase 1 [ Homo sapiens ] |
| Official Symbol | NEK1 |
| Synonyms | NEK1; NIMA (never in mitosis gene a)-related kinase 1; serine/threonine-protein kinase Nek1; KIAA1901; NY REN 55; |
| Gene ID | 4750 |
| mRNA Refseq | NM_001199397 |
| Protein Refseq | NP_001186326 |
| MIM | 604588 |
| Uniprot ID | Q96PY6 |
| Chromosome Location | 4q32.3 |
| Function | ATP binding; metal ion binding; nucleotide binding; protein binding; protein kinase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEK1 Products
Required fields are marked with *
My Review for All NEK1 Products
Required fields are marked with *



