Recombinant Human NEK1
Cat.No. : | NEK1-29277TH |
Product Overview : | Recombinant fragment of Human NEK1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a serine/threonine kinase involved in cell cycle regulation. The encoded protein is found in a centrosomal complex with FEZ1, a neuronal protein that plays a role in axonal development. Defects in this gene are a cause of polycystic kidney disease (PKD). Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | High fetal expression in the brain and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVRQD |
Sequence Similarities : | Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.Contains 1 protein kinase domain. |
Gene Name | NEK1 NIMA (never in mitosis gene a)-related kinase 1 [ Homo sapiens ] |
Official Symbol | NEK1 |
Synonyms | NEK1; NIMA (never in mitosis gene a)-related kinase 1; serine/threonine-protein kinase Nek1; KIAA1901; NY REN 55; |
Gene ID | 4750 |
mRNA Refseq | NM_001199397 |
Protein Refseq | NP_001186326 |
MIM | 604588 |
Uniprot ID | Q96PY6 |
Chromosome Location | 4q32.3 |
Function | ATP binding; metal ion binding; nucleotide binding; protein binding; protein kinase activity; |
◆ Recombinant Proteins | ||
NEK1-9928H | Active Recombinant Human NEK1 Protein, GST-tagged | +Inquiry |
NEK1-3610H | Recombinant Human NEK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NEK1-705H | Recombinant Human NEK1 | +Inquiry |
NEK1-2993H | Active Recombinant Human NEK1 Protein, GST-tagged | +Inquiry |
NEK1-3124H | Recombinant Human NEK1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEK1 Products
Required fields are marked with *
My Review for All NEK1 Products
Required fields are marked with *
0
Inquiry Basket