Recombinant Human NEK1 protein, GST-tagged
Cat.No. : | NEK1-301539H |
Product Overview : | Recombinant Human NEK1 (557-740 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Lys557-Asp740 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | NEK1 NIMA (never in mitosis gene a)-related kinase 1 [ Homo sapiens ] |
Official Symbol | NEK1 |
Synonyms | NEK1; NIMA (never in mitosis gene a)-related kinase 1; serine/threonine-protein kinase Nek1; KIAA1901; NY REN 55; nimA-related protein kinase 1; protein-serine/threonine kinase; renal carcinoma antigen NY-REN-55; never in mitosis A-related kinase 1; SRPS2; NY-REN-55; MGC138800; DKFZp686D06121; DKFZp686K12169; |
Gene ID | 4750 |
mRNA Refseq | NM_001199397 |
Protein Refseq | NP_001186326 |
MIM | 604588 |
UniProt ID | Q96PY6 |
◆ Recombinant Proteins | ||
NEK1-1437M | Active Recombinant Mouse NEK1, GST-tagged | +Inquiry |
NEK1-9928H | Active Recombinant Human NEK1 Protein, GST-tagged | +Inquiry |
Nek1-2039M | Recombinant Mouse Nek1 Protein, GST-tagged | +Inquiry |
NEK1-29277TH | Recombinant Human NEK1 | +Inquiry |
NEK1-3124H | Recombinant Human NEK1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEK1 Products
Required fields are marked with *
My Review for All NEK1 Products
Required fields are marked with *
0
Inquiry Basket